![]() | BDGP Sequence Production Resources |
Search the DGRC for IP05602
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14312-RA |
Protein status: | IP05602.pep: gold |
Preliminary Size: | 327 |
Sequenced Size: | 518 |
Gene | Date | Evidence |
---|---|---|
CG14312 | 2005-01-01 | Successful iPCR screen |
CG14312 | 2008-04-29 | Release 5.5 accounting |
CG14312 | 2008-08-15 | Release 5.9 accounting |
CG14312 | 2008-12-18 | 5.12 accounting |
518 bp assembled on 2006-11-09
GenBank Submission: BT023641
> IP05602.complete AAAACGTTTAAGATAACTCTGTTTTTGGCCAGCTCAAGCTGCAGTTTTTT CACAAATAGCACAGAACAGAGATCCAAATATGTCTACCTATCCCAGTGCT TCCGCATCCCAGTCGACAGGAACCTCTGACCTGGACACCGAGTCCGTGGA AGTTCTGCGGGAGCGGCTGAGCACCATGAAGCGGCTGATGGCCGAGCGGA CGTCCCAGCAGCAAAACAACCCGGCGACCACGGAGGAGATATTCTCCACC AAGCGCCACCGCTCGGCGGGCATCATCGATGGAAACTTCCTGAGCATCGC GTTCGGCGGAGCTCTGCTGGTGATCATCACGGTTTCGGTGTACGCCTTCT ACAGTCTCTACCATGCCATACTCAAGAAGTTCCCTTCGCGCCACGAGGAG CTGTAAACGATGCCAAATTCGATGGCGGTTTTCCGCTTACACACAATTAT GTACGAGTTTCTGCATTTAATAATAAATTGTAGCATGAATTTTACTATCA AAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14312-RA | 542 | CG14312-RA | 24..527 | 1..504 | 2520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14107272..14107651 | 120..499 | 100 | <- | Minus |
chr3R | 14107709..14107827 | 1..119 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..499 | 1..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..499 | 1..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..327 | 80..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14312-RA | 1..494 | 6..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18282978..18283357 | 120..499 | 100 | <- | Minus |
3R | 18283415..18283533 | 1..119 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18282978..18283357 | 120..499 | 100 | <- | Minus |
3R | 18283415..18283533 | 1..119 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18282978..18283357 | 120..499 | 100 | <- | Minus |
3R | 18283415..18283533 | 1..119 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14108700..14109079 | 120..499 | 100 | <- | Minus |
arm_3R | 14109137..14109255 | 1..119 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18023809..18024188 | 120..499 | 100 | <- | Minus |
3R | 18024246..18024364 | 1..119 | 100 | Minus |
Translation from 79 to 405
> IP05602.hyp MSTYPSASASQSTGTSDLDTESVEVLRERLSTMKRLMAERTSQQQNNPAT TEEIFSTKRHRSAGIIDGNFLSIAFGGALLVIITVSVYAFYSLYHAILKK FPSRHEEL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14312-PA | 108 | CG14312-PA | 1..108 | 1..108 | 533 | 100 | Plus |
Translation from 79 to 405
> IP05602.pep MSTYPSASASQSTGTSDLDTESVEVLRERLSTMKRLMAERTSQQQNNPAT TEEIFSTKRHRSAGIIDGNFLSIAFGGALLVIITVSVYAFYSLYHAILKK FPSRHEEL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23146-PA | 108 | GF23146-PA | 1..108 | 1..108 | 538 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16553-PA | 108 | GG16553-PA | 1..108 | 1..108 | 560 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22283-PA | 101 | GH22283-PA | 2..101 | 9..108 | 482 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14312-PA | 108 | CG14312-PA | 1..108 | 1..108 | 533 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23091-PA | 101 | GI23091-PA | 2..101 | 9..108 | 494 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22121-PA | 110 | GL22121-PA | 1..110 | 1..108 | 511 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12899-PA | 110 | GA12899-PA | 1..110 | 1..108 | 511 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15308-PA | 108 | GM15308-PA | 1..108 | 1..108 | 556 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22711-PA | 101 | GJ22711-PA | 2..101 | 9..108 | 478 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22779-PA | 108 | GK22779-PA | 1..108 | 1..108 | 516 | 89.8 | Plus |