Clone IP05602 Report

Search the DGRC for IP05602

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:2
Vector:pOT2
Associated Gene/TranscriptCG14312-RA
Protein status:IP05602.pep: gold
Preliminary Size:327
Sequenced Size:518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14312 2005-01-01 Successful iPCR screen
CG14312 2008-04-29 Release 5.5 accounting
CG14312 2008-08-15 Release 5.9 accounting
CG14312 2008-12-18 5.12 accounting

Clone Sequence Records

IP05602.complete Sequence

518 bp assembled on 2006-11-09

GenBank Submission: BT023641

> IP05602.complete
AAAACGTTTAAGATAACTCTGTTTTTGGCCAGCTCAAGCTGCAGTTTTTT
CACAAATAGCACAGAACAGAGATCCAAATATGTCTACCTATCCCAGTGCT
TCCGCATCCCAGTCGACAGGAACCTCTGACCTGGACACCGAGTCCGTGGA
AGTTCTGCGGGAGCGGCTGAGCACCATGAAGCGGCTGATGGCCGAGCGGA
CGTCCCAGCAGCAAAACAACCCGGCGACCACGGAGGAGATATTCTCCACC
AAGCGCCACCGCTCGGCGGGCATCATCGATGGAAACTTCCTGAGCATCGC
GTTCGGCGGAGCTCTGCTGGTGATCATCACGGTTTCGGTGTACGCCTTCT
ACAGTCTCTACCATGCCATACTCAAGAAGTTCCCTTCGCGCCACGAGGAG
CTGTAAACGATGCCAAATTCGATGGCGGTTTTCCGCTTACACACAATTAT
GTACGAGTTTCTGCATTTAATAATAAATTGTAGCATGAATTTTACTATCA
AAAAAAAAAAAAAAAAAA

IP05602.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14312-RA 542 CG14312-RA 24..527 1..504 2520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14107272..14107653 499..118 1910 100 Minus
chr3R 27901430 chr3R 14107708..14107827 120..1 600 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18282973..18283359 504..118 1935 100 Minus
3R 32079331 3R 18283414..18283533 120..1 600 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18023804..18024190 504..118 1935 100 Minus
3R 31820162 3R 18024245..18024364 120..1 600 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:57:20 has no hits.

IP05602.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:58:26 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14107272..14107651 120..499 100 <- Minus
chr3R 14107709..14107827 1..119 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:31 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:49 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:12 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:24 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:13 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:10 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:49 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..499 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:12 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..499 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:24 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..327 80..406 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:13 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
CG14312-RA 1..494 6..499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:58:26 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18282978..18283357 120..499 100 <- Minus
3R 18283415..18283533 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:58:26 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18282978..18283357 120..499 100 <- Minus
3R 18283415..18283533 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:58:26 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18282978..18283357 120..499 100 <- Minus
3R 18283415..18283533 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:12 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14108700..14109079 120..499 100 <- Minus
arm_3R 14109137..14109255 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:04 Download gff for IP05602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18023809..18024188 120..499 100 <- Minus
3R 18024246..18024364 1..119 100   Minus

IP05602.hyp Sequence

Translation from 79 to 405

> IP05602.hyp
MSTYPSASASQSTGTSDLDTESVEVLRERLSTMKRLMAERTSQQQNNPAT
TEEIFSTKRHRSAGIIDGNFLSIAFGGALLVIITVSVYAFYSLYHAILKK
FPSRHEEL*

IP05602.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14312-PA 108 CG14312-PA 1..108 1..108 533 100 Plus

IP05602.pep Sequence

Translation from 79 to 405

> IP05602.pep
MSTYPSASASQSTGTSDLDTESVEVLRERLSTMKRLMAERTSQQQNNPAT
TEEIFSTKRHRSAGIIDGNFLSIAFGGALLVIITVSVYAFYSLYHAILKK
FPSRHEEL*

IP05602.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23146-PA 108 GF23146-PA 1..108 1..108 538 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16553-PA 108 GG16553-PA 1..108 1..108 560 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22283-PA 101 GH22283-PA 2..101 9..108 482 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14312-PA 108 CG14312-PA 1..108 1..108 533 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23091-PA 101 GI23091-PA 2..101 9..108 494 92 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22121-PA 110 GL22121-PA 1..110 1..108 511 90 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12899-PA 110 GA12899-PA 1..110 1..108 511 90 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15308-PA 108 GM15308-PA 1..108 1..108 556 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22711-PA 101 GJ22711-PA 2..101 9..108 478 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22779-PA 108 GK22779-PA 1..108 1..108 516 89.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11091-PA 108 GE11091-PA 1..108 1..108 556 98.1 Plus
Dyak\GE25218-PA 108 GE25218-PA 1..108 1..108 556 98.1 Plus