Clone IP05608 Report

Search the DGRC for IP05608

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:8
Vector:pOT2
Associated Gene/TranscriptCG14370-RA
Protein status:IP05608.pep: gold
Preliminary Size:399
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14370 2005-01-01 Successful iPCR screen
CG14370 2008-04-29 Release 5.5 accounting
CG14370 2008-08-15 Release 5.9 accounting
CG14370 2008-12-18 5.12 accounting

Clone Sequence Records

IP05608.complete Sequence

747 bp (747 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023642

> IP05608.complete
AACGACACCTCTGCCAAGTAGCTTCGTAAAAAATTTGTCAAAGCCGGGGT
AAATCGAAAACAAAAACGTAGAAACGTGGTGCGAAGTAAAAATTGCAATC
GCAGACAAAAGCGCACACGGTACGCAAAAGTTTGCATTTCAAGAGTCAAT
TTCCCTGCTGAGTTTGCTGCATAAGTTCGAGATTGTGAAAATGGTCAAGC
ATCTGGACAATGGACTTGTGTTCTACCGACTGATGCTGAGCTTTCCGCTA
AGAATTGCACTGTATGCGGTGTACGTTTACCTGGAGAATTTGCTGGGGCT
GATGCTTTTGATCCAGGAAGTTCTGGTCCTTCAATTTCTATTCCTCTGCA
TGGTCATCCGGTGGGTATACCCACCGTGGCCAGCAAATGGTATCGCTTCA
TCGCTGAGGTTTCGCACACGGAAAGCCCTCCAGATCTTCCTGACCATCTG
GATCGTATTGCTCAACACGACCACCTATACGTGGAGCATCCCATGCCAGG
GCATCATGCAACTCAGCCGACTATTCCGGATATGCGCCTATAGTCGCACC
TGGATCATGATACAGCGCCACAATGGCGCCCGACGCTGAAAAATTATCCT
GCGAGAGCAATAAACGTTCGCAAGTGCATGAAATTTAATGCTCGGTTGGT
GGACTCAAATCCGCATTGCTCTGCGCGGTATTTGGAGTAAAGCAGGGTAT
AAGTGGTTAATAAAAATTGAACTAAAAATAAAAAAAAAAAAAAAAAA

IP05608.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14370-RA 723 CG14370-RA 1..723 1..723 3615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9412932..9413660 1..729 3600 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13587997..13588726 1..730 3650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13328828..13329557 1..730 3650 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:10:05 has no hits.

IP05608.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9412932..9413660 1..729 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:32 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:23 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:05:27 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:37:15 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:37 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:23 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:05:27 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..399 191..589 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:37:15 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
CG14370-RA 1..729 1..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13587997..13588725 1..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13587997..13588725 1..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:53 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13587997..13588725 1..729 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:05:27 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9413719..9414447 1..729 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:22 Download gff for IP05608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13328828..13329556 1..729 100   Plus

IP05608.hyp Sequence

Translation from 190 to 588

> IP05608.hyp
MVKHLDNGLVFYRLMLSFPLRIALYAVYVYLENLLGLMLLIQEVLVLQFL
FLCMVIRWVYPPWPANGIASSLRFRTRKALQIFLTIWIVLLNTTTYTWSI
PCQGIMQLSRLFRICAYSRTWIMIQRHNGARR*

IP05608.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14370-PA 132 CG14370-PA 1..132 1..132 693 100 Plus

IP05608.pep Sequence

Translation from 190 to 588

> IP05608.pep
MVKHLDNGLVFYRLMLSFPLRIALYAVYVYLENLLGLMLLIQEVLVLQFL
FLCMVIRWVYPPWPANGIASSLRFRTRKALQIFLTIWIVLLNTTTYTWSI
PCQGIMQLSRLFRICAYSRTWIMIQRHNGARR*

IP05608.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19747-PA 133 GG19747-PA 1..133 1..132 422 64.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14370-PA 132 CG14370-PA 1..132 1..132 693 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24114-PA 133 GM24114-PA 1..133 1..132 496 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26280-PA 133 GE26280-PA 1..133 1..132 439 67.7 Plus