IP05619.complete Sequence
467 bp (467 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023639
> IP05619.complete
AGCAAGACAGACAGCAACAAAAAAAATCAAGAAAATGTCGGAAAAGAAAT
ATTGGGAGCCGGCAAAGGCTTTCCGCCCAAAAAACGAGAGGGCGAAAGTA
AGTATCTGGCACCAGTCATTCACACCGACGTACGAGCAGGAGGAGCCCCA
AATGGCACTGCTTCTATCCTGGCACTACGGTCGCCAGTGGATGGAGGAGC
GTGATATACACAGGATGGAGACCAAGTTGAAGATAAAGAAGGAGGCCAAC
TTCATTCCACCCAACTATACCAGTTGGCTTGAGAAGCGGAGGGCCATAAA
GACTAAGCAACAGCTGATCAGATCTTGACGTTTTATTTGTGTTCATTAAG
TTGTCCAGTTTTTGAATATGAAATTTTGTAAAAATTGTTAATTGTCTTCA
CGTTCTGGCTTTTTTATAAAATGTGTATCTAAATGAATAAAGATAATACA
AAAAAAAAAAAAAAAAA
IP05619.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14659-RA | 449 | CG14659-RA | 1..449 | 1..449 | 2245 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:51:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr3R | 27901430 | chr3R | 656545..656993 | 449..1 | 2245 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 4830844..4831297 | 454..1 | 2270 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 31820162 | 3R | 4571675..4572128 | 454..1 | 2270 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 15:51:00 has no hits.
IP05619.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:52:16 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr3R | 656545..656993 | 1..449 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:37 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:24 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:43:32 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:54 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:41 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:39 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:24 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..449 | 1..449 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:43:32 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..449 | 1..449 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:54 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..294 | 35..328 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:41 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14659-RA | 1..449 | 1..449 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:16 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 4830849..4831297 | 1..449 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:16 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 4830849..4831297 | 1..449 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:16 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 4830849..4831297 | 1..449 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:43:32 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 656571..657019 | 1..449 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:24 Download gff for
IP05619.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 4571680..4572128 | 1..449 | 100 | | Minus |
IP05619.hyp Sequence
Translation from 0 to 327
> IP05619.hyp
ARQTATKKIKKMSEKKYWEPAKAFRPKNERAKVSIWHQSFTPTYEQEEPQ
MALLLSWHYGRQWMEERDIHRMETKLKIKKEANFIPPNYTSWLEKRRAIK
TKQQLIRS*
IP05619.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14659-PA | 97 | CG14659-PA | 1..97 | 12..108 | 527 | 100 | Plus |
IP05619.pep Sequence
Translation from 34 to 327
> IP05619.pep
MSEKKYWEPAKAFRPKNERAKVSIWHQSFTPTYEQEEPQMALLLSWHYGR
QWMEERDIHRMETKLKIKKEANFIPPNYTSWLEKRRAIKTKQQLIRS*
IP05619.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:08:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF19866-PA | 97 | GF19866-PA | 1..88 | 1..88 | 263 | 50 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:08:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG11300-PA | 97 | GG11300-PA | 1..97 | 1..97 | 367 | 67 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14659-PA | 97 | CG14659-PA | 1..97 | 1..97 | 527 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:08:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dper\GL21620-PA | 102 | GL21620-PA | 1..81 | 1..85 | 168 | 44.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:08:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dpse\GA13154-PA | 102 | GA13154-PA | 1..81 | 1..85 | 169 | 44.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:08:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM10673-PA | 97 | GM10673-PA | 1..97 | 1..97 | 415 | 79.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:08:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD19648-PA | 97 | GD19648-PA | 1..97 | 1..97 | 400 | 76.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:08:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\GJ16600-PA | 164 | GJ16600-PA | 30..98 | 27..95 | 133 | 41.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:08:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE25324-PA | 97 | GE25324-PA | 1..97 | 1..97 | 358 | 68 | Plus |
