IP05624.complete Sequence
540 bp (540 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023640
> IP05624.complete
TTAACCTAAATTTTAGTATTTCTTTGACCAACGGTACGGCATCCACCTAT
GGCATAATGTTCACCGGTCGGCTTCTCATCGGGTCCCCGATATTCGAGGC
TAAGATGCGGCTACAGCAGAGGCGACGAATGTCAGAGCACAGGCTTCCGT
ACCATCGCAGACCTGCGCCCGTAAAGCTCCAGGACCGTAAGAGTTCATGG
ACCGATCTAAAAAGGCCGCCCTTCCTGCTGGTCAAGAGCTTCCTCAACTT
GCGCCACATGGACGCCGACTACGGGAAGGACATGACACGAGTTACGGACG
AGCTAAGTTTCCAGCCCCACCGCACCCTCTTAATCAATACCGTGCGAGGG
CCGCATCGTCAGTTTTCGGACACGGAACCAATTGCGGACATGATGGATAA
AAGTCCGGTAGCTTTGGACTCGGATTCGAAGCCGTGAGTGTGGGTAATAG
CGTTTAAATGGAAGATAATGTATTTTAATATAAATGTTTATTTTTAATTT
TATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP05624.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14759.a | 557 | CG14759.a | 70..557 | 17..504 | 2440 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:30:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 4147475..4147978 | 1..504 | 2475 | 99.4 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:30:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8259980..8260486 | 1..507 | 2535 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 8261179..8261685 | 1..507 | 2535 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 00:30:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 924..980 | 501..445 | 131 | 74.1 | Minus |
Dbuz\BuT2 | 2775 | Dbuz\BuT2 BUT2 2775bp | 290..329 | 503..464 | 110 | 75 | Minus |
Damb\P-element_T | 3329 | Damb\P-element_T P_T 3329bp Derived from AF012414. | 2561..2601 | 502..459 | 105 | 75 | Minus |
IP05624.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:31:14 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 4147475..4147943 | 1..469 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:38 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:26 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:45 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:55 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:03:36 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:42 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:26 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 17..520 | 1..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:45 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 140..643 | 1..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:56 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 1..381 | 57..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:03:36 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14759-RA | 140..643 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:14 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259980..8260483 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:14 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259980..8260483 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:14 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259980..8260483 | 1..504 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:45 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4147485..4147988 | 1..504 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:25 Download gff for
IP05624.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8261179..8261682 | 1..504 | 100 | | Plus |
IP05624.hyp Sequence
Translation from 2 to 436
> IP05624.hyp
NLNFSISLTNGTASTYGIMFTGRLLIGSPIFEAKMRLQQRRRMSEHRLPY
HRRPAPVKLQDRKSSWTDLKRPPFLLVKSFLNLRHMDADYGKDMTRVTDE
LSFQPHRTLLINTVRGPHRQFSDTEPIADMMDKSPVALDSDSKP*
IP05624.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14759-PB | 126 | CG14759-PB | 1..126 | 19..144 | 662 | 100 | Plus |
CG14759-PA | 126 | CG14759-PA | 1..126 | 19..144 | 662 | 100 | Plus |
IP05624.pep Sequence
Translation from 56 to 436
> IP05624.pep
MFTGRLLIGSPIFEAKMRLQQRRRMSEHRLPYHRRPAPVKLQDRKSSWTD
LKRPPFLLVKSFLNLRHMDADYGKDMTRVTDELSFQPHRTLLINTVRGPH
RQFSDTEPIADMMDKSPVALDSDSKP*
IP05624.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:08:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12349-PA | 150 | GF12349-PA | 19..99 | 22..101 | 234 | 56.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:08:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23348-PA | 126 | GG23348-PA | 1..126 | 1..126 | 523 | 80.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14759-PB | 126 | CG14759-PB | 1..126 | 1..126 | 662 | 100 | Plus |
CG14759-PA | 126 | CG14759-PA | 1..126 | 1..126 | 662 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:08:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21020-PA | 126 | GM21020-PA | 1..126 | 1..126 | 521 | 81 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:08:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10554-PA | 126 | GD10554-PA | 1..126 | 1..126 | 546 | 84.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:08:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19188-PA | 122 | GE19188-PA | 1..121 | 1..125 | 503 | 80.8 | Plus |