Clone IP05629 Report

Search the DGRC for IP05629

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:29
Vector:pOT2
Associated Gene/TranscriptCG14903-RA
Protein status:IP05629.pep: validated not full length
Preliminary Size:360
Sequenced Size:420

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14903 2005-01-01 Successful iPCR screen
CG14903 2008-04-29 Release 5.5 accounting
CG14903 2008-08-15 Release 5.9 accounting
CG14903 2008-12-18 5.12 accounting

Clone Sequence Records

IP05629.complete Sequence

420 bp (420 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022418

> IP05629.complete
TAATATTGTACAGTATATTGTAGTTCGCAGCGACTTGCGTTCCGCCCTTA
GTTGGCCCTTGGGGGCGGTGATCGCTCAGAGTTGCCATGCCACAGCCGCC
GTCATTCACTTGAATTCCGAGGACGCCGACACTGTGGCCTACTTGAACGA
TCTGGATAATATGCACAAAGTGGTGCTGGAGGCCAAAGATGAGAGTGCTC
TGGTCAAGCTCAGTGAAAAGTTAAAGGAGAACGAGATTAAACACAAGTTG
TGGATCGAACAGCCCGAAAATATCCCAACCTGCATCGCCTTGAAACCTTA
TGTTAAGGACACGGTTCATAAATATGTCAAGCACCTTAAGCTTTTAAAAG
AGTAATTCATTATTGTTGTATATGCTTATTGACACTAAAAATTTAAGAAA
AAGAAAAAAAAAAAAAAAAA

IP05629.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-RA 478 CG14903-RA 71..477 1..407 2035 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12397718..12397941 403..180 1120 100 Minus
chr3R 27901430 chr3R 12398067..12398248 182..1 910 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16573175..16573402 407..180 1140 100 Minus
3R 32079331 3R 16573532..16573713 182..1 910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16314006..16314233 407..180 1140 100 Minus
3R 31820162 3R 16314363..16314544 182..1 910 100 Minus
Blast to na_te.dros performed 2019-03-16 06:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6660..6738 378..299 127 63.7 Minus

IP05629.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12397718..12397939 182..403 100 <- Minus
chr3R 12398068..12398248 1..181 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:42 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:52 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:17 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:47 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:21 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:52 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 40..442 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 40..442 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:17 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 6..360 1..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:47 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 40..442 1..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16573179..16573400 182..403 100 <- Minus
3R 16573533..16573713 1..181 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16573179..16573400 182..403 100 <- Minus
3R 16573533..16573713 1..181 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16573179..16573400 182..403 100 <- Minus
3R 16573533..16573713 1..181 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:27 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12398901..12399122 182..403 100 <- Minus
arm_3R 12399255..12399435 1..181 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:52 Download gff for IP05629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16314010..16314231 182..403 100 <- Minus
3R 16314364..16314544 1..181 100   Minus

IP05629.hyp Sequence

Translation from 0 to 354

> IP05629.hyp
NIVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHLNSEDADTVAYLND
LDNMHKVVLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALKPY
VKDTVHKYVKHLKLLKE*

IP05629.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-PA 119 CG14903-PA 3..119 1..117 600 100 Plus

IP05629.pep Sequence

Translation from 1 to 354

> IP05629.pep
NIVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHLNSEDADTVAYLND
LDNMHKVVLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALKPY
VKDTVHKYVKHLKLLKE*

IP05629.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17936-PA 119 GF17936-PA 3..118 1..116 543 88.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16824-PA 119 GG16824-PA 3..119 1..117 580 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24142-PA 118 GH24142-PA 3..118 1..116 515 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-PA 119 CG14903-PA 3..119 1..117 600 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16396-PA 129 GI16396-PA 3..108 1..106 474 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27294-PA 119 GL27294-PA 3..119 1..117 554 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13341-PA 119 GA13341-PA 3..119 1..117 548 87.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15422-PA 119 GM15422-PA 3..119 1..117 599 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20280-PA 64 GD20280-PA 1..64 54..117 317 100 Plus
Dsim\GD20279-PA 49 GD20279-PA 3..47 1..45 226 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17017-PA 118 GJ17017-PA 3..118 1..116 505 83.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11867-PA 111 GK11867-PA 3..111 1..109 497 83.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26143-PA 119 GE26143-PA 3..119 1..117 582 95.7 Plus