BDGP Sequence Production Resources |
Search the DGRC for IP05629
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 29 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14903-RA |
Protein status: | IP05629.pep: validated not full length |
Preliminary Size: | 360 |
Sequenced Size: | 420 |
Gene | Date | Evidence |
---|---|---|
CG14903 | 2005-01-01 | Successful iPCR screen |
CG14903 | 2008-04-29 | Release 5.5 accounting |
CG14903 | 2008-08-15 | Release 5.9 accounting |
CG14903 | 2008-12-18 | 5.12 accounting |
420 bp (420 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022418
> IP05629.complete TAATATTGTACAGTATATTGTAGTTCGCAGCGACTTGCGTTCCGCCCTTA GTTGGCCCTTGGGGGCGGTGATCGCTCAGAGTTGCCATGCCACAGCCGCC GTCATTCACTTGAATTCCGAGGACGCCGACACTGTGGCCTACTTGAACGA TCTGGATAATATGCACAAAGTGGTGCTGGAGGCCAAAGATGAGAGTGCTC TGGTCAAGCTCAGTGAAAAGTTAAAGGAGAACGAGATTAAACACAAGTTG TGGATCGAACAGCCCGAAAATATCCCAACCTGCATCGCCTTGAAACCTTA TGTTAAGGACACGGTTCATAAATATGTCAAGCACCTTAAGCTTTTAAAAG AGTAATTCATTATTGTTGTATATGCTTATTGACACTAAAAATTTAAGAAA AAGAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14903-RA | 478 | CG14903-RA | 71..477 | 1..407 | 2035 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 6660..6738 | 378..299 | 127 | 63.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12397718..12397939 | 182..403 | 100 | <- | Minus |
chr3R | 12398068..12398248 | 1..181 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 40..442 | 1..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 40..442 | 1..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 6..360 | 1..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14903-RA | 40..442 | 1..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16573179..16573400 | 182..403 | 100 | <- | Minus |
3R | 16573533..16573713 | 1..181 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16573179..16573400 | 182..403 | 100 | <- | Minus |
3R | 16573533..16573713 | 1..181 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16573179..16573400 | 182..403 | 100 | <- | Minus |
3R | 16573533..16573713 | 1..181 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12398901..12399122 | 182..403 | 100 | <- | Minus |
arm_3R | 12399255..12399435 | 1..181 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16314010..16314231 | 182..403 | 100 | <- | Minus |
3R | 16314364..16314544 | 1..181 | 100 | Minus |
Translation from 0 to 354
> IP05629.hyp NIVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHLNSEDADTVAYLND LDNMHKVVLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALKPY VKDTVHKYVKHLKLLKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14903-PA | 119 | CG14903-PA | 3..119 | 1..117 | 600 | 100 | Plus |
Translation from 1 to 354
> IP05629.pep NIVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHLNSEDADTVAYLND LDNMHKVVLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALKPY VKDTVHKYVKHLKLLKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17936-PA | 119 | GF17936-PA | 3..118 | 1..116 | 543 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16824-PA | 119 | GG16824-PA | 3..119 | 1..117 | 580 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24142-PA | 118 | GH24142-PA | 3..118 | 1..116 | 515 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14903-PA | 119 | CG14903-PA | 3..119 | 1..117 | 600 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16396-PA | 129 | GI16396-PA | 3..108 | 1..106 | 474 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27294-PA | 119 | GL27294-PA | 3..119 | 1..117 | 554 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13341-PA | 119 | GA13341-PA | 3..119 | 1..117 | 548 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15422-PA | 119 | GM15422-PA | 3..119 | 1..117 | 599 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20280-PA | 64 | GD20280-PA | 1..64 | 54..117 | 317 | 100 | Plus |
Dsim\GD20279-PA | 49 | GD20279-PA | 3..47 | 1..45 | 226 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17017-PA | 118 | GJ17017-PA | 3..118 | 1..116 | 505 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11867-PA | 111 | GK11867-PA | 3..111 | 1..109 | 497 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26143-PA | 119 | GE26143-PA | 3..119 | 1..117 | 582 | 95.7 | Plus |