BDGP Sequence Production Resources |
Search the DGRC for IP05635
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 35 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15167-RA |
Protein status: | IP05635.pep: gold |
Preliminary Size: | 351 |
Sequenced Size: | 520 |
Gene | Date | Evidence |
---|---|---|
CG15167 | 2005-01-01 | Successful iPCR screen |
CG15167 | 2008-04-29 | Release 5.5 accounting |
CG15167 | 2008-08-15 | Release 5.9 accounting |
CG15167 | 2008-12-18 | 5.12 accounting |
520 bp (520 high quality bases) assembled on 2006-09-27
GenBank Submission: BT029050
> IP05635.complete AGAGAGAGAGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTTCAAAAGCCG TGAAAACTCACATACTCAAATTTCCATTCCCAAAAATGTCGCTGGAACTG GTACTCCAACCGCAGCCAGAGATCTACCTATTAGCGTATGAAATGAGTGT GCCCGAAGATTCCGATGAGGCCCTGCTTTCAGTTGTGGCCCACAAAGCCG CAGAACTTAAGGTGTGTGGCTACATCGCGCATACGCACTGTGGCCGCAAA GTGGGCGGCGAACTGGAGGGCAGCTCTGCTGGCCTGCAGATGATGGTCGA GTGGATGCAGGCTAGGAGCCAGGGGAATCATCTCGGGGACGGGGAGAAGA TCAAAAGCCAGATGAAGGAGCCACGATTCTCGAAGTGGAAGCTGCAATCA GGGGCCCCCAAATACGATGTTTTCTTCTGTTGCTGAGTGCTGACGAGAGG AGTTGATTAAAAATCGCAAATTGCATTGGCCCCAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15167-RA | 442 | CG15167-RA | 1..442 | 42..483 | 2210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18739105..18739554 | 34..483 | 2235 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18740358..18740808 | 34..484 | 2240 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18740358..18740808 | 34..484 | 2240 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18739106..18739554 | 35..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..450 | 35..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..450 | 35..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..351 | 86..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15167-RA | 1..450 | 35..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18740359..18740807 | 36..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18740359..18740807 | 36..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18740359..18740807 | 36..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18740359..18740807 | 36..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18740359..18740807 | 36..483 | 99 | Plus |
Translation from 36 to 435
> IP05635.hyp LFSKAVKTHILKFPFPKMSLELVLQPQPEIYLLAYEMSVPEDSDEALLSV VAHKAAELKVCGYIAHTHCGRKVGGELEGSSAGLQMMVEWMQARSQGNHL GDGEKIKSQMKEPRFSKWKLQSGAPKYDVFFCC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15167-PA | 116 | CG15167-PA | 1..116 | 18..133 | 614 | 100 | Plus |
Translation from 85 to 435
> IP05635.pep MSLELVLQPQPEIYLLAYEMSVPEDSDEALLSVVAHKAAELKVCGYIAHT HCGRKVGGELEGSSAGLQMMVEWMQARSQGNHLGDGEKIKSQMKEPRFSK WKLQSGAPKYDVFFCC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15416-PA | 115 | GF15416-PA | 1..115 | 1..116 | 278 | 55.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21130-PA | 115 | GG21130-PA | 1..115 | 1..116 | 543 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10543-PA | 102 | GH10543-PA | 13..102 | 13..116 | 148 | 34.6 | Plus |
Dgri\GH23541-PA | 102 | GH23541-PA | 13..102 | 13..116 | 140 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15167-PA | 116 | CG15167-PA | 1..116 | 1..116 | 614 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20900-PA | 102 | GI20900-PA | 1..102 | 1..116 | 162 | 36.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17292-PA | 116 | GM17292-PA | 1..116 | 1..116 | 607 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24155-PA | 116 | GD24155-PA | 1..116 | 1..116 | 601 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19854-PA | 102 | GJ19854-PA | 1..102 | 1..116 | 174 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19021-PA | 109 | GK19021-PA | 14..109 | 13..116 | 141 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13204-PA | 115 | GE13204-PA | 1..115 | 1..116 | 545 | 87.9 | Plus |