Clone IP05635 Report

Search the DGRC for IP05635

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:35
Vector:pOT2
Associated Gene/TranscriptCG15167-RA
Protein status:IP05635.pep: gold
Preliminary Size:351
Sequenced Size:520

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15167 2005-01-01 Successful iPCR screen
CG15167 2008-04-29 Release 5.5 accounting
CG15167 2008-08-15 Release 5.9 accounting
CG15167 2008-12-18 5.12 accounting

Clone Sequence Records

IP05635.complete Sequence

520 bp (520 high quality bases) assembled on 2006-09-27

GenBank Submission: BT029050

> IP05635.complete
AGAGAGAGAGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTTCAAAAGCCG
TGAAAACTCACATACTCAAATTTCCATTCCCAAAAATGTCGCTGGAACTG
GTACTCCAACCGCAGCCAGAGATCTACCTATTAGCGTATGAAATGAGTGT
GCCCGAAGATTCCGATGAGGCCCTGCTTTCAGTTGTGGCCCACAAAGCCG
CAGAACTTAAGGTGTGTGGCTACATCGCGCATACGCACTGTGGCCGCAAA
GTGGGCGGCGAACTGGAGGGCAGCTCTGCTGGCCTGCAGATGATGGTCGA
GTGGATGCAGGCTAGGAGCCAGGGGAATCATCTCGGGGACGGGGAGAAGA
TCAAAAGCCAGATGAAGGAGCCACGATTCTCGAAGTGGAAGCTGCAATCA
GGGGCCCCCAAATACGATGTTTTCTTCTGTTGCTGAGTGCTGACGAGAGG
AGTTGATTAAAAATCGCAAATTGCATTGGCCCCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

IP05635.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-RA 442 CG15167-RA 1..442 42..483 2210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18739105..18739554 34..483 2235 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18740358..18740808 34..484 2240 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18740358..18740808 34..484 2240 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 21:49:12 has no hits.

IP05635.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:50:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18739106..18739554 35..483 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:42 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:46 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:59:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:44:09 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:03:40 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:57 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:46 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..450 35..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:59:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..450 35..483 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:57 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..351 86..436 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:03:40 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..450 35..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18740359..18740807 36..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18740359..18740807 36..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18740359..18740807 36..483 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:59:16 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18740359..18740807 36..483 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:18 Download gff for IP05635.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18740359..18740807 36..483 99   Plus

IP05635.hyp Sequence

Translation from 36 to 435

> IP05635.hyp
LFSKAVKTHILKFPFPKMSLELVLQPQPEIYLLAYEMSVPEDSDEALLSV
VAHKAAELKVCGYIAHTHCGRKVGGELEGSSAGLQMMVEWMQARSQGNHL
GDGEKIKSQMKEPRFSKWKLQSGAPKYDVFFCC*

IP05635.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-PA 116 CG15167-PA 1..116 18..133 614 100 Plus

IP05635.pep Sequence

Translation from 85 to 435

> IP05635.pep
MSLELVLQPQPEIYLLAYEMSVPEDSDEALLSVVAHKAAELKVCGYIAHT
HCGRKVGGELEGSSAGLQMMVEWMQARSQGNHLGDGEKIKSQMKEPRFSK
WKLQSGAPKYDVFFCC*

IP05635.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15416-PA 115 GF15416-PA 1..115 1..116 278 55.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21130-PA 115 GG21130-PA 1..115 1..116 543 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10543-PA 102 GH10543-PA 13..102 13..116 148 34.6 Plus
Dgri\GH23541-PA 102 GH23541-PA 13..102 13..116 140 33.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-PA 116 CG15167-PA 1..116 1..116 614 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20900-PA 102 GI20900-PA 1..102 1..116 162 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17292-PA 116 GM17292-PA 1..116 1..116 607 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24155-PA 116 GD24155-PA 1..116 1..116 601 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19854-PA 102 GJ19854-PA 1..102 1..116 174 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19021-PA 109 GK19021-PA 14..109 13..116 141 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13204-PA 115 GE13204-PA 1..115 1..116 545 87.9 Plus