Clone IP05651 Report

Search the DGRC for IP05651

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:51
Vector:pOT2
Associated Gene/TranscriptCG15449-RA
Protein status:IP05651.pep: gold
Preliminary Size:396
Sequenced Size:739

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15449 2005-01-01 Successful iPCR screen
CG15449 2008-04-29 Release 5.5 accounting
CG15449 2008-08-15 Release 5.9 accounting
CG15449 2008-12-18 5.12 accounting

Clone Sequence Records

IP05651.complete Sequence

739 bp (739 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023637

> IP05651.complete
CCGTCGCGAGCACGCTCCAAAGAGGCCAATCGGAAGAACTTTGGAACTTT
CTTGAGTTGCGACACGTACATTTTCAAGCTGGACCACATTTTCGAGGACT
GTCAGCGGCAGCAGTTTCACAAAATGTCTCATGGCGAGCGAAAAGGCCGC
CTCAATGTGGTCAAGTTTCTCGAACTGGGTTTTGCGGTAGCGTGTCTGGT
GCTCCACTTCTACAGCTTCAACGATCGCGATATAATGACTTCGTTCCTGG
CCACTGGCACCTTCACGGGCTACATCATAGTGGTCATCGGGGTCTTTGCA
GGCGTTCTGATGCGGGCACCCATTCACAAGCGCATCGATATATTCTTCAG
CGTCCTGGGCTGCACCTTGTTCGTGGCCAGCGGTGTGTTCATCATTGAGG
CCTGGGAGTTCTCCTTCCGCACCCGAACTCGGGATCTCGCGCTCATCAAG
GCCTCGCTGTCCATCGTCAATGGGGTGCTATTCGGATTCGATGCGGTGTT
CACATTTCGCGACAAGTGAATCGTTCAGTTTTTAGACGGAAACCACTGGC
CAGATCCGCTGGAGCTTCTTTCGTATGCATTTAATAGCTTATAAGGGTAT
ACATATCTTTCCGGTTCAACTGGCCATTCCGCCAATCATACAAACAACCA
AACTGTTAACGTTTATCTTTATATTTAAGTGTTTTTTTTTTCTCTCAATA
AAAAGTAATTCGCCATCGCTCAAAAAAAAAAAAAAAAAA

IP05651.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15449.a 1441 CG15449.a 721..1441 1..721 3605 100 Plus
CG15449-RA 817 CG15449-RA 97..817 1..721 3605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20904671..20905096 721..296 2130 100 Minus
chrX 22417052 chrX 20905541..20905718 178..1 890 100 Minus
chrX 22417052 chrX 20905192..20905317 302..177 630 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21039512..21039939 723..296 2140 100 Minus
X 23542271 X 21040384..21040561 178..1 890 100 Minus
X 23542271 X 21040035..21040160 302..177 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21024604..21025031 723..296 2140 100 Minus
X 23527363 X 21025476..21025653 178..1 890 100 Minus
X 23527363 X 21025127..21025252 302..177 630 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:59:03 has no hits.

IP05651.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:00:07 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20904671..20905090 302..721 100 <- Minus
chrX 20905193..20905316 178..301 100 <- Minus
chrX 20905542..20905718 1..177 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:47 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:27 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:27 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:56 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:18:23 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:43 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:27 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 45..765 1..721 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:27 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 45..765 1..721 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:56 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 1..396 124..519 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:18:23 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
CG15449-RA 45..765 1..721 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:07 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
X 21039514..21039933 302..721 100 <- Minus
X 21040036..21040159 178..301 100 <- Minus
X 21040385..21040561 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:07 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
X 21039514..21039933 302..721 100 <- Minus
X 21040036..21040159 178..301 100 <- Minus
X 21040385..21040561 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:07 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
X 21039514..21039933 302..721 100 <- Minus
X 21040036..21040159 178..301 100 <- Minus
X 21040385..21040561 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:27 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20910541..20910960 302..721 100 <- Minus
arm_X 20911063..20911186 178..301 100 <- Minus
arm_X 20911412..20911588 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:26 Download gff for IP05651.complete
Subject Subject Range Query Range Percent Splice Strand
X 21024606..21025025 302..721 100 <- Minus
X 21025128..21025251 178..301 100 <- Minus
X 21025477..21025653 1..177 100   Minus

IP05651.hyp Sequence

Translation from 0 to 518

> IP05651.hyp
PSRARSKEANRKNFGTFLSCDTYIFKLDHIFEDCQRQQFHKMSHGERKGR
LNVVKFLELGFAVACLVLHFYSFNDRDIMTSFLATGTFTGYIIVVIGVFA
GVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEFSFRTRTRDLALIK
ASLSIVNGVLFGFDAVFTFRDK*

IP05651.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15449-PA 131 CG15449-PA 1..131 42..172 665 100 Plus
CG44325-PD 146 CG44325-PD 8..126 53..172 159 31.4 Plus
CG44325-PE 125 CG44325-PE 8..120 53..166 158 32.2 Plus
CG44325-PB 125 CG44325-PB 8..120 53..166 158 32.2 Plus

IP05651.pep Sequence

Translation from 123 to 518

> IP05651.pep
MSHGERKGRLNVVKFLELGFAVACLVLHFYSFNDRDIMTSFLATGTFTGY
IIVVIGVFAGVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEFSFRT
RTRDLALIKASLSIVNGVLFGFDAVFTFRDK*

IP05651.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21858-PA 131 GF21858-PA 1..131 1..131 663 100 Plus
Dana\GF19114-PA 125 GF19114-PA 8..124 12..129 152 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17559-PA 131 GG17559-PA 1..131 1..131 661 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12523-PA 131 GH12523-PA 1..131 1..131 644 95.4 Plus
Dgri\GH17713-PA 235 GH17713-PA 2..120 5..123 148 35 Plus
Dgri\GH17713-PA 235 GH17713-PA 123..234 18..129 144 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15449-PA 131 CG15449-PA 1..131 1..131 665 100 Plus
CG44325-PD 146 CG44325-PD 8..126 12..131 159 31.4 Plus
CG44325-PE 125 CG44325-PE 8..120 12..125 158 32.2 Plus
CG44325-PB 125 CG44325-PB 8..120 12..125 158 32.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14877-PA 131 GI14877-PA 1..131 1..131 646 95.4 Plus
Dmoj\GI15457-PA 119 GI15457-PA 8..118 19..129 154 34.2 Plus
Dmoj\GI15456-PA 128 GI15456-PA 2..128 5..131 144 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16585-PA 131 GL16585-PA 1..131 1..131 655 97.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13737-PA 131 GA13737-PA 1..131 1..131 655 97.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22643-PA 121 GM22643-PA 9..121 19..131 568 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15513-PA 131 GD15513-PA 1..131 1..131 663 100 Plus
Dsim\GD16087-PA 125 GD16087-PA 2..124 5..129 155 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19540-PA 131 GJ19540-PA 1..131 1..131 643 94.7 Plus
Dvir\GJ19171-PA 126 GJ19171-PA 2..125 5..129 161 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10090-PA 131 GK10090-PA 1..131 1..131 637 93.1 Plus
Dwil\GK16752-PA 206 GK16752-PA 2..94 5..98 142 37 Plus
Dwil\GK16752-PA 206 GK16752-PA 96..205 19..129 136 30.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15320-PA 131 GE15320-PA 1..131 1..131 663 100 Plus