Clone IP05657 Report

Search the DGRC for IP05657

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:57
Vector:pOT2
Associated Gene/TranscriptAcp53C14b-RA
Protein status:IP05657.pep: gold
Preliminary Size:399
Sequenced Size:499

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15616 2005-01-01 Successful iPCR screen
Acp53C14b 2008-04-29 Release 5.5 accounting
Acp53C14b 2008-08-15 Release 5.9 accounting
Acp53C14b 2008-12-18 5.12 accounting

Clone Sequence Records

IP05657.complete Sequence

499 bp (499 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023638

> IP05657.complete
ATCGCGACTTAAAACAGGAGAATGAGCGTGATCAAGTCCATATTTCTGCT
CAGTATTTTGGCTGTCTGCCTCATTCCCCGGGAGACGGAGGCCCAGGCCA
CTATAAGTGAAAGCTGGGGAAGGCTGGGCAAGTGTACTCAGGTGGCCATC
GAAACACTGACCAGCCTGGCCGATAAAATCGTCCCGACCGTATATGAGTT
GAAACAATGCTCCGGATACGTAACTTTGGAACCGGCAAACGGCAAAGACA
GAAAGATTACCTGGTACCTAAAGGTATCCTATGAATTCTTCAAGAAACTT
GTCTTTGACGAACCCAAATGTCTGCACGGTCTACTGAACAAGTTGGCTGC
CACAATCAAACCATTTGCCGAGCAGATATCGGGATTAGGTTGCTTGGACG
AAGAAGATTATATCATTTAAAAAGAAAAGTGTGCACATTACATAAATAAA
TCGAGAGCAATATGGGGTCTCAAATGTCAGCAAAAAAAAAAAAAAAAAA

IP05657.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14b-RA 571 Acp53C14b-RA 35..523 1..489 2430 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12636125..12636542 481..64 2030 99 Minus
chr2R 21145070 chr2R 12636597..12636661 65..1 295 96.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16748898..16749323 489..64 2115 99.8 Minus
2R 25286936 2R 16749378..16749442 65..1 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16750097..16750522 489..64 2115 99.7 Minus
2R 25260384 2R 16750577..16750641 65..1 325 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:29:59 has no hits.

IP05657.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:30:45 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12636125..12636542 64..481 99 <- Minus
chr2R 12636599..12636661 1..63 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:49 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 1..399 22..420 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:28 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 1..399 22..420 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:50:25 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 1..399 22..420 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:57 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 1..399 22..420 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:41 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 1..399 22..420 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:45 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 6..486 1..481 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:28 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 6..486 1..481 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:50:25 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 6..486 1..481 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:58 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 6..486 1..481 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:41 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14b-RA 19..499 1..481 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748906..16749323 64..481 100 <- Minus
2R 16749380..16749442 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748906..16749323 64..481 100 <- Minus
2R 16749380..16749442 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748906..16749323 64..481 100 <- Minus
2R 16749380..16749442 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:50:25 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12636885..12636947 1..63 100   Minus
arm_2R 12636411..12636828 64..481 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:27 Download gff for IP05657.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16750105..16750522 64..481 100 <- Minus
2R 16750579..16750641 1..63 100   Minus

IP05657.hyp Sequence

Translation from 21 to 419

> IP05657.hyp
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII*

IP05657.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14b-PB 132 CG15616-PB 1..132 1..132 679 100 Plus
Acp53C14b-PA 132 CG15616-PA 1..132 1..132 679 100 Plus
Acp53C14a-PB 121 CG8626-PB 1..121 1..127 136 26.8 Plus
Acp53C14a-PA 121 CG8626-PA 1..121 1..127 136 26.8 Plus

IP05657.pep Sequence

Translation from 21 to 419

> IP05657.pep
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII*

IP05657.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13450-PA 131 GF13450-PA 1..131 1..132 424 58.3 Plus
Dana\GF13451-PA 121 GF13451-PA 1..121 1..127 144 29.1 Plus
Dana\GF13449-PA 118 GF13449-PA 25..118 31..127 139 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22247-PA 132 GG22247-PA 1..132 1..132 572 80.3 Plus
Dere\GG22248-PA 121 GG22248-PA 1..121 1..127 132 26.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14b-PB 132 CG15616-PB 1..132 1..132 679 100 Plus
Acp53C14b-PA 132 CG15616-PA 1..132 1..132 679 100 Plus
Acp53C14a-PB 121 CG8626-PB 1..121 1..127 136 26.8 Plus
Acp53C14a-PA 121 CG8626-PA 1..121 1..127 136 26.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11816-PA 132 GL11816-PA 1..132 1..132 363 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Acp53C14b-PA 132 GA13850-PA 1..132 1..132 363 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20035-PA 132 GM20035-PA 1..132 1..132 632 91.7 Plus
Dsec\GM20036-PA 121 GM20036-PA 1..121 1..127 136 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp53C14b-PA 132 GD25519-PA 1..132 1..132 645 92.4 Plus
Dsim\Acp53C14a-PA 121 GD25520-PA 1..121 1..127 136 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14039-PA 132 GE14039-PA 1..132 1..132 581 80.3 Plus
Dyak\GE14040-PA 121 GE14040-PA 1..121 1..127 137 24.4 Plus