IP05657.complete Sequence
499 bp (499 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023638
> IP05657.complete
ATCGCGACTTAAAACAGGAGAATGAGCGTGATCAAGTCCATATTTCTGCT
CAGTATTTTGGCTGTCTGCCTCATTCCCCGGGAGACGGAGGCCCAGGCCA
CTATAAGTGAAAGCTGGGGAAGGCTGGGCAAGTGTACTCAGGTGGCCATC
GAAACACTGACCAGCCTGGCCGATAAAATCGTCCCGACCGTATATGAGTT
GAAACAATGCTCCGGATACGTAACTTTGGAACCGGCAAACGGCAAAGACA
GAAAGATTACCTGGTACCTAAAGGTATCCTATGAATTCTTCAAGAAACTT
GTCTTTGACGAACCCAAATGTCTGCACGGTCTACTGAACAAGTTGGCTGC
CACAATCAAACCATTTGCCGAGCAGATATCGGGATTAGGTTGCTTGGACG
AAGAAGATTATATCATTTAAAAAGAAAAGTGTGCACATTACATAAATAAA
TCGAGAGCAATATGGGGTCTCAAATGTCAGCAAAAAAAAAAAAAAAAAA
IP05657.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14b-RA | 571 | Acp53C14b-RA | 35..523 | 1..489 | 2430 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:30:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 12636125..12636542 | 481..64 | 2030 | 99 | Minus |
chr2R | 21145070 | chr2R | 12636597..12636661 | 65..1 | 295 | 96.9 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:29:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16748898..16749323 | 489..64 | 2115 | 99.8 | Minus |
2R | 25286936 | 2R | 16749378..16749442 | 65..1 | 325 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 16750097..16750522 | 489..64 | 2115 | 99.7 | Minus |
2R | 25260384 | 2R | 16750577..16750641 | 65..1 | 325 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 21:29:59 has no hits.
IP05657.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:30:45 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 12636125..12636542 | 64..481 | 99 | <- | Minus |
chr2R | 12636599..12636661 | 1..63 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:49 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 1..399 | 22..420 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:28 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 1..399 | 22..420 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:50:25 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 1..399 | 22..420 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:57 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 1..399 | 22..420 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:41 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 1..399 | 22..420 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:45 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 6..486 | 1..481 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:28 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 6..486 | 1..481 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:50:25 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 6..486 | 1..481 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:58 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 6..486 | 1..481 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:41 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14b-RA | 19..499 | 1..481 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748906..16749323 | 64..481 | 100 | <- | Minus |
2R | 16749380..16749442 | 1..63 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748906..16749323 | 64..481 | 100 | <- | Minus |
2R | 16749380..16749442 | 1..63 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:45 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748906..16749323 | 64..481 | 100 | <- | Minus |
2R | 16749380..16749442 | 1..63 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:50:25 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12636885..12636947 | 1..63 | 100 | | Minus |
arm_2R | 12636411..12636828 | 64..481 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:27 Download gff for
IP05657.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16750105..16750522 | 64..481 | 100 | <- | Minus |
2R | 16750579..16750641 | 1..63 | 100 | | Minus |
IP05657.hyp Sequence
Translation from 21 to 419
> IP05657.hyp
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII*
IP05657.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14b-PB | 132 | CG15616-PB | 1..132 | 1..132 | 679 | 100 | Plus |
Acp53C14b-PA | 132 | CG15616-PA | 1..132 | 1..132 | 679 | 100 | Plus |
Acp53C14a-PB | 121 | CG8626-PB | 1..121 | 1..127 | 136 | 26.8 | Plus |
Acp53C14a-PA | 121 | CG8626-PA | 1..121 | 1..127 | 136 | 26.8 | Plus |
IP05657.pep Sequence
Translation from 21 to 419
> IP05657.pep
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII*
IP05657.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13450-PA | 131 | GF13450-PA | 1..131 | 1..132 | 424 | 58.3 | Plus |
Dana\GF13451-PA | 121 | GF13451-PA | 1..121 | 1..127 | 144 | 29.1 | Plus |
Dana\GF13449-PA | 118 | GF13449-PA | 25..118 | 31..127 | 139 | 32 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22247-PA | 132 | GG22247-PA | 1..132 | 1..132 | 572 | 80.3 | Plus |
Dere\GG22248-PA | 121 | GG22248-PA | 1..121 | 1..127 | 132 | 26.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14b-PB | 132 | CG15616-PB | 1..132 | 1..132 | 679 | 100 | Plus |
Acp53C14b-PA | 132 | CG15616-PA | 1..132 | 1..132 | 679 | 100 | Plus |
Acp53C14a-PB | 121 | CG8626-PB | 1..121 | 1..127 | 136 | 26.8 | Plus |
Acp53C14a-PA | 121 | CG8626-PA | 1..121 | 1..127 | 136 | 26.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11816-PA | 132 | GL11816-PA | 1..132 | 1..132 | 363 | 48.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\Acp53C14b-PA | 132 | GA13850-PA | 1..132 | 1..132 | 363 | 48.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20035-PA | 132 | GM20035-PA | 1..132 | 1..132 | 632 | 91.7 | Plus |
Dsec\GM20036-PA | 121 | GM20036-PA | 1..121 | 1..127 | 136 | 26.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp53C14b-PA | 132 | GD25519-PA | 1..132 | 1..132 | 645 | 92.4 | Plus |
Dsim\Acp53C14a-PA | 121 | GD25520-PA | 1..121 | 1..127 | 136 | 26.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14039-PA | 132 | GE14039-PA | 1..132 | 1..132 | 581 | 80.3 | Plus |
Dyak\GE14040-PA | 121 | GE14040-PA | 1..121 | 1..127 | 137 | 24.4 | Plus |