Clone IP05660 Report

Search the DGRC for IP05660

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:60
Vector:pOT2
Associated Gene/TranscriptCG15649-RA
Protein status:IP05660.pep: gold
Preliminary Size:377
Sequenced Size:456

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15649 2005-01-01 Successful iPCR screen
CG15649 2008-04-29 Release 5.5 accounting
CG15649 2008-08-15 Release 5.9 accounting
CG15649 2008-12-18 5.12 accounting

Clone Sequence Records

IP05660.complete Sequence

456 bp (456 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022425

> IP05660.complete
TGACTCGCACGGGCGGCTCCTCAGCGTCGAAAAGCAGACTCGAATCGAGA
CAATGTTACACCTGAGATTTGTCTTTATGGCCGCTTTACCGCTGCTGCTG
TTGCTTCTACTTCAGTTTAGTCCACCTGCAGATGGCTTTATCATTCGACT
GATTACGGAGACACTGCAGAATAACGTGGCTGGTGAGCCGGTTCTTCACG
AGCGGACTTCTTGGGACTTTGATCCGGAGGCGGCCAAGAGGGCCAGATCG
CTGTACTACGAGAAGAACGGATTCCGCTCGTCCAAATTCATCGAGCGACT
GGGCGTTGGTCTGGATGGGCGGCACGAGGAGCGGCGGGCGGAGCAAGGAC
ATCGCGATGTGGGACGACTGAATGGGGAACACAATGTGAACTATCCGCCT
CCACCGGCTTAGCCATAAATAATTATGATTTAAATTTAAAAAAAAAAAAA
AAAAAA

IP05660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15649.a 903 CG15649.a 124..562 1..439 2195 100 Plus
CG15649-RB 903 CG15649-RB 124..562 1..439 2195 100 Plus
CG15649-RA 560 CG15649-RA 124..560 1..437 2185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16859663..16859839 437..261 885 100 Minus
chr2R 21145070 chr2R 16859901..16860077 262..86 885 100 Minus
chr2R 21145070 chr2R 16860351..16860435 85..1 425 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20973218..20973396 439..261 895 100 Minus
2R 25286936 2R 20973458..20973634 262..86 885 100 Minus
2R 25286936 2R 20973908..20973992 85..1 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20974417..20974595 439..261 895 100 Minus
2R 25260384 2R 20974657..20974833 262..86 885 100 Minus
2R 25260384 2R 20975107..20975191 85..1 425 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:07:05 has no hits.

IP05660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:07:44 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16859663..16859837 263..437 100 <- Minus
chr2R 16859901..16860077 86..262 100 <- Minus
chr2R 16860351..16860435 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:50 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..360 53..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:12 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RB 1..360 53..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:19 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..360 53..412 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:56 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..360 53..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..360 53..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:02:35 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:12 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RB 6..442 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:19 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 26..462 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:56 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:24 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
CG15649-RA 26..462 1..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:44 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20973220..20973394 263..437 100 <- Minus
2R 20973458..20973634 86..262 100 <- Minus
2R 20973908..20973992 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:44 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20973220..20973394 263..437 100 <- Minus
2R 20973458..20973634 86..262 100 <- Minus
2R 20973908..20973992 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:44 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20973220..20973394 263..437 100 <- Minus
2R 20973458..20973634 86..262 100 <- Minus
2R 20973908..20973992 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:19 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16860725..16860899 263..437 100 <- Minus
arm_2R 16860963..16861139 86..262 100 <- Minus
arm_2R 16861413..16861497 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:05 Download gff for IP05660.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20974419..20974593 263..437 100 <- Minus
2R 20974657..20974833 86..262 100 <- Minus
2R 20975107..20975191 1..85 100   Minus

IP05660.hyp Sequence

Translation from 0 to 411

> IP05660.hyp
DSHGRLLSVEKQTRIETMLHLRFVFMAALPLLLLLLLQFSPPADGFIIRL
ITETLQNNVAGEPVLHERTSWDFDPEAAKRARSLYYEKNGFRSSKFIERL
GVGLDGRHEERRAEQGHRDVGRLNGEHNVNYPPPPA*

IP05660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG15649-PB 119 CG15649-PB 1..119 18..136 626 100 Plus
CG15649-PA 119 CG15649-PA 1..119 18..136 626 100 Plus

IP05660.pep Sequence

Translation from 52 to 411

> IP05660.pep
MLHLRFVFMAALPLLLLLLLQFSPPADGFIIRLITETLQNNVAGEPVLHE
RTSWDFDPEAAKRARSLYYEKNGFRSSKFIERLGVGLDGRHEERRAEQGH
RDVGRLNGEHNVNYPPPPA*

IP05660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12735-PA 108 GF12735-PA 4..108 15..119 472 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20820-PA 117 GG20820-PA 1..117 1..119 536 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19874-PA 113 GH19874-PA 1..113 1..117 439 70.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15649-PB 119 CG15649-PB 1..119 1..119 626 100 Plus
CG15649-PA 119 CG15649-PA 1..119 1..119 626 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19823-PA 112 GI19823-PA 1..112 1..116 401 72.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17415-PA 116 GL17415-PA 1..116 1..119 409 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13869-PA 116 GA13869-PA 1..116 1..119 414 70.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15767-PA 119 GM15767-PA 1..119 1..119 613 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25242-PA 119 GD25242-PA 1..119 1..119 556 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18581-PA 116 GJ18581-PA 6..116 9..119 439 71.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22872-PA 126 GK22872-PA 23..126 16..119 475 82.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13761-PA 119 GE13761-PA 1..119 1..119 540 92.4 Plus