Clone IP05665 Report

Search the DGRC for IP05665

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:65
Vector:pOT2
Associated Gene/TranscriptGbp-RA
Protein status:IP05665.pep: gold
Preliminary Size:357
Sequenced Size:463

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15917 2005-01-01 Successful iPCR screen
CG15917 2008-04-29 Release 5.5 accounting
CG15917 2008-08-15 Release 5.9 accounting
CG15917 2008-12-18 5.12 accounting

Clone Sequence Records

IP05665.complete Sequence

463 bp (463 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023635

> IP05665.complete
CGAAGCTTCATCGTAGCAAACGAGCGTGCATCTCGGAGATAATGTTGATA
CGTATTAATCCATTGGTGCTGTGCATCCTACCGCTGGTCTTCCTCCTCAC
CGAGGCGAGAACACGGCCCAGTGGTAACGATCGCATCGTTTTTCCAAAGG
ATGACGACGATACCAGCTCGAGATTCACATACTCGACCACAACGACAACT
GAGGAACCCGCATCCACAATAGCACTCCGTTTGGAAAGTACAAACAGCAC
AGAACAGATCACCAGCGGATCGGAGGAGCTGGTTAATGAAAACACCACTG
TGCTGCCAGTTATAGACAACCGAATATTGCTGGAGACGACCCAAAAATGT
AAGCCTGGCTTTGAGCTGTTCGGAAAACGATGCAGAAAGCCGGCGTAATC
TGTAGTCGCTAAGATTGATGTTAGCCAATAAAGTGATATTTGTGTAGAAA
AAAAAAAAAAAAA

IP05665.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15917-RA 449 CG15917-RA 1..449 1..449 2245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13023648..13024094 1..447 2130 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17136457..17136905 1..449 2245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17137656..17138104 1..449 2245 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:01:40 has no hits.

IP05665.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:02:56 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13023648..13024094 1..447 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:52 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..357 42..398 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:29 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..357 42..398 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:26 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
Gbp-RA 1..357 42..398 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:58 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..357 42..398 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:08 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
Gbp-RA 1..357 42..398 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:47 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:29 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:26 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
Gbp-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:59 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15917-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:08 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
Gbp-RA 7..453 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:56 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17136457..17136903 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:56 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17136457..17136903 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:56 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17136457..17136903 1..447 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:26 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13023962..13024408 1..447 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:29 Download gff for IP05665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17137656..17138102 1..447 100   Plus

IP05665.hyp Sequence

Translation from 2 to 397

> IP05665.hyp
KLHRSKRACISEIMLIRINPLVLCILPLVFLLTEARTRPSGNDRIVFPKD
DDDTSSRFTYSTTTTTEEPASTIALRLESTNSTEQITSGSEELVNENTTV
LPVIDNRILLETTQKCKPGFELFGKRCRKPA*

IP05665.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Gbp-PA 118 CG15917-PA 1..118 14..131 600 100 Plus

IP05665.pep Sequence

Translation from 41 to 397

> IP05665.pep
MLIRINPLVLCILPLVFLLTEARTRPSGNDRIVFPKDDDDTSSRFTYSTT
TTTEEPASTIALRLESTNSTEQITSGSEELVNENTTVLPVIDNRILLETT
QKCKPGFELFGKRCRKPA*

IP05665.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11445-PA 122 GF11445-PA 6..122 5..118 200 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20666-PA 126 GG20666-PA 1..126 1..118 461 73 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Gbp1-PA 118 CG15917-PA 1..118 1..118 600 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18610-PA 119 GI18610-PA 6..119 5..118 157 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17239-PA 121 GL17239-PA 10..121 8..118 231 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25053-PA 122 GA25053-PA 11..122 8..118 231 48.2 Plus
Dpse\GA22236-PA 122 GA22236-PA 15..122 12..118 224 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21762-PA 114 GM21762-PA 1..114 1..118 460 89 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11253-PA 114 GD11253-PA 1..114 1..118 454 89.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18882-PA 131 GK18882-PA 1..131 15..118 141 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11651-PA 124 GE11651-PA 1..124 1..118 448 72.6 Plus