BDGP Sequence Production Resources |
Search the DGRC for IP05665
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 65 |
Vector: | pOT2 |
Associated Gene/Transcript | Gbp-RA |
Protein status: | IP05665.pep: gold |
Preliminary Size: | 357 |
Sequenced Size: | 463 |
Gene | Date | Evidence |
---|---|---|
CG15917 | 2005-01-01 | Successful iPCR screen |
CG15917 | 2008-04-29 | Release 5.5 accounting |
CG15917 | 2008-08-15 | Release 5.9 accounting |
CG15917 | 2008-12-18 | 5.12 accounting |
463 bp (463 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023635
> IP05665.complete CGAAGCTTCATCGTAGCAAACGAGCGTGCATCTCGGAGATAATGTTGATA CGTATTAATCCATTGGTGCTGTGCATCCTACCGCTGGTCTTCCTCCTCAC CGAGGCGAGAACACGGCCCAGTGGTAACGATCGCATCGTTTTTCCAAAGG ATGACGACGATACCAGCTCGAGATTCACATACTCGACCACAACGACAACT GAGGAACCCGCATCCACAATAGCACTCCGTTTGGAAAGTACAAACAGCAC AGAACAGATCACCAGCGGATCGGAGGAGCTGGTTAATGAAAACACCACTG TGCTGCCAGTTATAGACAACCGAATATTGCTGGAGACGACCCAAAAATGT AAGCCTGGCTTTGAGCTGTTCGGAAAACGATGCAGAAAGCCGGCGTAATC TGTAGTCGCTAAGATTGATGTTAGCCAATAAAGTGATATTTGTGTAGAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15917-RA | 449 | CG15917-RA | 1..449 | 1..449 | 2245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13023648..13024094 | 1..447 | 2130 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17136457..17136905 | 1..449 | 2245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17137656..17138104 | 1..449 | 2245 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13023648..13024094 | 1..447 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..357 | 42..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..357 | 42..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gbp-RA | 1..357 | 42..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..357 | 42..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gbp-RA | 1..357 | 42..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..447 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..447 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gbp-RA | 1..447 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15917-RA | 1..447 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gbp-RA | 7..453 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17136457..17136903 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17136457..17136903 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17136457..17136903 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13023962..13024408 | 1..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17137656..17138102 | 1..447 | 100 | Plus |
Translation from 2 to 397
> IP05665.hyp KLHRSKRACISEIMLIRINPLVLCILPLVFLLTEARTRPSGNDRIVFPKD DDDTSSRFTYSTTTTTEEPASTIALRLESTNSTEQITSGSEELVNENTTV LPVIDNRILLETTQKCKPGFELFGKRCRKPA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gbp-PA | 118 | CG15917-PA | 1..118 | 14..131 | 600 | 100 | Plus |
Translation from 41 to 397
> IP05665.pep MLIRINPLVLCILPLVFLLTEARTRPSGNDRIVFPKDDDDTSSRFTYSTT TTTEEPASTIALRLESTNSTEQITSGSEELVNENTTVLPVIDNRILLETT QKCKPGFELFGKRCRKPA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11445-PA | 122 | GF11445-PA | 6..122 | 5..118 | 200 | 46.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20666-PA | 126 | GG20666-PA | 1..126 | 1..118 | 461 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gbp1-PA | 118 | CG15917-PA | 1..118 | 1..118 | 600 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18610-PA | 119 | GI18610-PA | 6..119 | 5..118 | 157 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17239-PA | 121 | GL17239-PA | 10..121 | 8..118 | 231 | 48.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25053-PA | 122 | GA25053-PA | 11..122 | 8..118 | 231 | 48.2 | Plus |
Dpse\GA22236-PA | 122 | GA22236-PA | 15..122 | 12..118 | 224 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21762-PA | 114 | GM21762-PA | 1..114 | 1..118 | 460 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11253-PA | 114 | GD11253-PA | 1..114 | 1..118 | 454 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18882-PA | 131 | GK18882-PA | 1..131 | 15..118 | 141 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11651-PA | 124 | GE11651-PA | 1..124 | 1..118 | 448 | 72.6 | Plus |