Clone IP05667 Report

Search the DGRC for IP05667

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:67
Vector:pOT2
Associated Gene/TranscriptCG17048-RA
Protein status:IP05667.pep: gold
Preliminary Size:375
Sequenced Size:579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17048 2005-01-01 Successful iPCR screen
CG17048 2008-04-29 Release 5.5 accounting
CG17048 2008-08-15 Release 5.9 accounting
CG17048 2008-12-18 5.12 accounting

Clone Sequence Records

IP05667.complete Sequence

579 bp (579 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023636

> IP05667.complete
CCCAACTGAAATCACATAAATAAATTGAAAACAAAATACCCAGACACGAA
GACACTATTACACGATCGCCACATATACAATACATTGAAAGACATAACAT
TTAGAAGACTAGACATAGAGAATCGAACGGGCATAATGGTACAGCAGGGC
CTCGATGCGACGAACTTTGGTCTGCGGAGCGACTACTCCAGTGAGAACGG
CGATCATCCATCGTTGTTCGATACGATTAAGGATGGGGATCAGCCGGATA
TGTGTGCCTTTTGCCTGGATCGCATACAGAATCCAGAGAAGCTGCACTGC
AATCATGCGTTCTGCAAAAGCTGTTTAGCACTGTACAGGGAAGCTCGCAA
CTGGGTGGCCAAGCGTTGCCCAATCTGTCGGAGCAGCCTGGACATGGATG
GCCAGGTGTCCAGGCAGTTCCACGATAACTGGCGTCTATTTGGTATTATG
ATGGTACCGCTGATGGTGCTCAGTCTGGGCCCCTTTTATTTGCTGTTGCT
TTACTGGTGAATTCGTTTACGAAATATGTATATTTGTATTAAGATAGATC
TATGCAAACTTAAAAAAAAAAAAAAAAAA

IP05667.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17048-RA 734 CG17048-RA 54..614 1..561 2805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9241386..9241811 426..1 2070 99.1 Minus
chr2R 21145070 chr2R 9241101..9241235 561..427 660 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13354043..13354468 426..1 2130 100 Minus
2R 25286936 2R 13353758..13353892 561..427 675 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13355242..13355667 426..1 2130 100 Minus
2R 25260384 2R 13354957..13355091 561..427 675 100 Minus
Blast to na_te.dros performed 2019-03-15 21:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 574..645 42..110 118 68.5 Plus

IP05667.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:04 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9241101..9241235 427..561 99 <- Minus
chr2R 9241386..9241811 1..426 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:53 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:31 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RB 1..375 136..510 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:50:53 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:59 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:02 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:49 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:31 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RB 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:50:53 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 54..614 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:00 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 1..375 136..510 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:02 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
CG17048-RA 32..592 1..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:04 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13353758..13353892 427..561 100 <- Minus
2R 13354043..13354468 1..426 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:04 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13353758..13353892 427..561 100 <- Minus
2R 13354043..13354468 1..426 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:04 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13353758..13353892 427..561 100 <- Minus
2R 13354043..13354468 1..426 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:50:53 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9241263..9241397 427..561 100 <- Minus
arm_2R 9241548..9241973 1..426 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:30 Download gff for IP05667.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13355242..13355667 1..426 100   Minus
2R 13354957..13355091 427..561 100 <- Minus

IP05667.pep Sequence

Translation from 135 to 509

> IP05667.pep
MVQQGLDATNFGLRSDYSSENGDHPSLFDTIKDGDQPDMCAFCLDRIQNP
EKLHCNHAFCKSCLALYREARNWVAKRCPICRSSLDMDGQVSRQFHDNWR
LFGIMMVPLMVLSLGPFYLLLLYW*

IP05667.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11193-PA 105 GF11193-PA 7..105 24..124 310 61.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22500-PA 123 GG22500-PA 1..123 1..124 506 77.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20274-PA 112 GH20274-PA 23..112 38..124 235 53.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17048-PB 124 CG17048-PB 1..124 1..124 689 100 Plus
CG17048-PA 124 CG17048-PA 1..124 1..124 689 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19443-PA 114 GI19443-PA 22..114 35..124 249 58.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11100-PA 113 GL11100-PA 10..113 12..124 238 49.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14295-PA 113 GA14295-PA 8..113 14..124 242 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20286-PA 114 GM20286-PA 4..114 14..124 514 84.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25767-PA 114 GD25767-PA 4..114 14..124 514 84.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21195-PA 130 GJ21195-PA 28..130 29..124 216 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13369-PA 120 GE13369-PA 1..120 1..124 420 74.2 Plus

IP05667.hyp Sequence

Translation from 135 to 509

> IP05667.hyp
MVQQGLDATNFGLRSDYSSENGDHPSLFDTIKDGDQPDMCAFCLDRIQNP
EKLHCNHAFCKSCLALYREARNWVAKRCPICRSSLDMDGQVSRQFHDNWR
LFGIMMVPLMVLSLGPFYLLLLYW*

IP05667.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17048-PB 124 CG17048-PB 1..124 1..124 689 100 Plus
CG17048-PA 124 CG17048-PA 1..124 1..124 689 100 Plus