Clone IP05674 Report

Search the DGRC for IP05674

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:74
Vector:pOT2
Associated Gene/TranscriptCG17856-RA
Protein status:IP05674.pep: gold
Preliminary Size:336
Sequenced Size:440

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17856 2005-01-01 Successful iPCR screen
CG17856 2008-04-29 Release 5.5 accounting
CG17856 2008-08-15 Release 5.9 accounting
CG17856 2008-12-18 5.12 accounting

Clone Sequence Records

IP05674.complete Sequence

440 bp (440 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023633

> IP05674.complete
ATCATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGGTTTTCTCCAAGTT
GGGAAAGTGGGCCTACAACATGTCTGGATTCAACCAATACGGCCTGTATC
GCGATGACTGTCTGTACGAGAATGAGGATGTGGCAGAAGCAGTGCGTCGT
CTGCCCCGCAAACTGTACGATGAACGCAACTATCGCATTCTTCGAGCACT
GCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAGCAGTGGACCAAGT
ACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAACGAAGTGCAAAAG
GAGCGCGAAGAGCGTGAGGAATGGAGCAAAACTCATTGATCCGGATACTT
CGGTTACAAAGAATGTCATAACCAAAACATAAAGGTTATTTAAATAAATC
GTTAATATAAATAGGCATAGAAAAAAAAAAAAAAAAAAAA

IP05674.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 420 CG17856-RA 1..420 1..420 2100 100 Plus
CG17856.a 476 CG17856.a 69..475 23..429 2035 100 Plus
CG3560-RA 569 CG3560-RA 122..443 3..324 650 80.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24117063..24117482 1..420 2100 100 Plus
chrX 22417052 chrX 16176392..16176622 94..324 525 81.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294131..28294559 1..429 2145 100 Plus
X 23542271 X 16286678..16286908 94..324 510 81.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28034962..28035390 1..429 2145 100 Plus
X 23527363 X 16294776..16295006 94..324 510 81.3 Plus
Blast to na_te.dros performed 2019-03-15 15:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 306..236 106 66.7 Minus

IP05674.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:21:29 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24117063..24117482 1..420 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:55 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:10 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:24:51 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:40 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:03 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:08 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:10 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 28..447 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:24:51 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 84..503 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:41 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 4..339 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:03 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 84..503 1..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:29 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28294131..28294550 1..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:29 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28294131..28294550 1..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:29 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28294131..28294550 1..420 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:24:51 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119853..24120272 1..420 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:10 Download gff for IP05674.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28034962..28035381 1..420 100   Plus

IP05674.hyp Sequence

Translation from 0 to 338

> IP05674.hyp
IMSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRR
LPRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQK
EREEREEWSKTH*

IP05674.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 111 CG17856-PA 1..111 2..112 596 100 Plus
CG3560-PA 111 CG3560-PA 1..111 2..112 528 85.6 Plus

IP05674.pep Sequence

Translation from 3 to 338

> IP05674.pep
MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRL
PRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKE
REEREEWSKTH*

IP05674.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19659-PA 111 GF19659-PA 1..111 1..111 520 84.7 Plus
Dana\GF19635-PA 111 GF19635-PA 1..111 1..111 485 87.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17947-PA 111 GG17947-PA 1..111 1..111 482 87.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12559-PA 111 GH12559-PA 1..111 1..111 468 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-14L-PA 111 CG17856-PA 1..111 1..111 596 100 Plus
UQCR-14-PA 111 CG3560-PA 1..111 1..111 528 85.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11212-PA 111 GI11212-PA 1..111 1..111 531 86.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21337-PA 111 GL21337-PA 1..111 1..111 474 84.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17519-PA 111 GA17519-PA 1..111 1..111 477 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16378-PA 111 GM16378-PA 1..111 1..111 582 99.1 Plus
Dsec\GM13417-PA 111 GM13417-PA 1..111 1..111 469 85.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21370-PA 111 GD21370-PA 1..111 1..111 582 99.1 Plus
Dsim\GD17271-PA 111 GD17271-PA 1..111 1..111 469 85.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18506-PA 111 GJ18506-PA 1..111 1..111 516 84.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19174-PA 111 GK19174-PA 1..111 1..111 520 84.7 Plus
Dwil\GK25718-PA 111 GK25718-PA 1..111 1..111 464 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23784-PA 111 GE23784-PA 1..111 1..111 572 96.4 Plus
Dyak\GE17257-PA 111 GE17257-PA 1..111 1..111 469 85.6 Plus