Clone IP05681 Report

Search the DGRC for IP05681

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:81
Vector:pOT2
Associated Gene/TranscriptCG18666-RA
Protein status:IP05681.pep: gold
Preliminary Size:384
Sequenced Size:529

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18666 2005-01-01 Successful iPCR screen
CG18666 2008-04-29 Release 5.5 accounting
CG18666 2008-08-15 Release 5.9 accounting
CG18666 2008-12-18 5.12 accounting

Clone Sequence Records

IP05681.complete Sequence

529 bp (529 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023631

> IP05681.complete
AATATGTCTGACAAGGATAAGAAAGATAAACCGGAACAGTTGGATGATGA
TTCCAGTGACGACGATGCCAACCAGAGAGCAGTTCGAGATCAGTATTCCG
ATCCTACCATCAGTGCATCCCCCTCGATTCTGCGACACCCCAACGCTCCC
CGTCCTGATATTTCAAGTGCCCCCTCGGTTGTCATTGCGTTGCCAAGTAG
CGAGACCCTCGTCGTGACCGAGGAAACTCCGGAGGAGCGACTCCGGCGAA
GAATGAGGTTTCTCGAGTTGCGGCGTGAGCACTACAACTACGTCAGCCAT
AGCGAGCAATGCAACATGGCGGATACGGAGGATGAAGATCACACGGAGAA
TCACCCAAAGTGTGAAGCCAATTGCAAGCCGGAATAGAGATTGGTTTCAT
TTTTTTTTAATTTTTAATTAAAACTACCGAAACTACCTTTCAATTAAATT
AGCATAAAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP05681.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG18666-RA 460 CG18666-RA 1..460 1..460 2300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11033605..11034064 1..460 2300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11034849..11035309 1..461 2305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11034849..11035309 1..461 2305 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:01:01 has no hits.

IP05681.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:02:01 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11033605..11034064 1..460 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:01 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:13 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:55:16 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:43 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:18:23 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:12 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:13 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..460 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:55:16 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 55..514 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:43 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 1..384 4..387 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:18:23 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18666-RA 55..514 1..460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:01 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11034849..11035308 1..460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:01 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11034849..11035308 1..460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:01 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11034849..11035308 1..460 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:55:16 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11034849..11035308 1..460 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:12 Download gff for IP05681.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11034849..11035308 1..460 100   Plus

IP05681.hyp Sequence

Translation from 0 to 386

> IP05681.hyp
NMSDKDKKDKPEQLDDDSSDDDANQRAVRDQYSDPTISASPSILRHPNAP
RPDISSAPSVVIALPSSETLVVTEETPEERLRRRMRFLELRREHYNYVSH
SEQCNMADTEDEDHTENHPKCEANCKPE*

IP05681.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG18666-PA 127 CG18666-PA 1..127 2..128 673 100 Plus

IP05681.pep Sequence

Translation from 3 to 386

> IP05681.pep
MSDKDKKDKPEQLDDDSSDDDANQRAVRDQYSDPTISASPSILRHPNAPR
PDISSAPSVVIALPSSETLVVTEETPEERLRRRMRFLELRREHYNYVSHS
EQCNMADTEDEDHTENHPKCEANCKPE*

IP05681.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23697-PA 131 GG23697-PA 1..131 1..127 384 66.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18666-PA 127 CG18666-PA 1..127 1..127 673 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18823-PA 127 GM18823-PA 1..127 1..127 550 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23756-PA 127 GD23756-PA 1..127 1..127 559 91.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18508-PA 133 GE18508-PA 1..133 1..127 434 72.2 Plus