BDGP Sequence Production Resources |
Search the DGRC for IP05684
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 84 |
Vector: | pOT2 |
Associated Gene/Transcript | CG2021-RA |
Protein status: | IP05684.pep: gold |
Preliminary Size: | 356 |
Sequenced Size: | 413 |
Gene | Date | Evidence |
---|---|---|
CG2021 | 2005-01-01 | Successful iPCR screen |
CG2021 | 2008-04-29 | Release 5.5 accounting |
CG2021 | 2008-08-15 | Release 5.9 accounting |
CG2021 | 2008-12-18 | 5.12 accounting |
413 bp (413 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023632
> IP05684.complete TCGCTAGCCTCTTGCCACAATTAGTATTTATTTTGTTCTGTTTGGAGAAG TTATCAAGGAAAGACTGCTAAAATGTCCGGTCTGGAGTCGTATATCAATC ACACAGTCTCCATCATTACGGCAGACGGACGGAACTTCATCGGGACACTC AAGGGATTCGACCAGACCATCAATATCATCATAGACGAGTGCCATGAGCG CGTCTTCTCTACCACCTCCGGCATCGAGCAAATCGTGCTGGGACTGCACA TCATCCGGGGGGACAACATCGCGGTGATCGGACTGATAGACGAGACCATC GACTCCCGCCTGGATTTGGCCAACATTAGGGGCGAGCCGCTGGGTCCCGT GGTGCACTAGGATAGCGAATAAAACCAGTGATTCTCAAGACTTAAAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2021-RA | 395 | CG2021-RA | 1..395 | 1..395 | 1975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1776570..1776962 | 393..1 | 1965 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1777008..1777402 | 395..1 | 1975 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1777008..1777402 | 395..1 | 1975 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1776570..1776962 | 1..393 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..288 | 73..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..288 | 73..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..288 | 73..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..288 | 73..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..288 | 73..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..354 | 40..393 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..354 | 40..393 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 10..402 | 1..393 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 1..354 | 40..393 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2021-RA | 10..402 | 1..393 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1777010..1777402 | 1..393 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1777010..1777402 | 1..393 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1777010..1777402 | 1..393 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1777010..1777402 | 1..393 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1777010..1777402 | 1..393 | 100 | Minus |
Translation from 72 to 359
> IP05684.hyp MSGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSG IEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGEPLGPVVH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2021-PA | 95 | CG2021-PA | 1..95 | 1..95 | 482 | 100 | Plus |
Translation from 72 to 359
> IP05684.pep MSGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSG IEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGEPLGPVVH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24963-PA | 95 | GF24963-PA | 1..95 | 1..95 | 477 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14562-PA | 95 | GG14562-PA | 1..95 | 1..95 | 477 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15765-PA | 95 | GH15765-PA | 1..95 | 1..95 | 466 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2021-PA | 95 | CG2021-PA | 1..95 | 1..95 | 482 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12774-PA | 95 | GI12774-PA | 1..95 | 1..95 | 471 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16212-PA | 95 | GL16212-PA | 1..95 | 1..95 | 467 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15189-PA | 95 | GA15189-PA | 1..95 | 1..95 | 467 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14170-PA | 95 | GM14170-PA | 1..95 | 1..95 | 477 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13439-PA | 95 | GD13439-PA | 1..95 | 1..95 | 477 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16072-PA | 95 | GJ16072-PA | 1..95 | 1..95 | 471 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20525-PA | 95 | GK20525-PA | 1..95 | 1..95 | 458 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20916-PA | 95 | GE20916-PA | 1..95 | 1..95 | 477 | 100 | Plus |