Clone IP05684 Report

Search the DGRC for IP05684

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:84
Vector:pOT2
Associated Gene/TranscriptCG2021-RA
Protein status:IP05684.pep: gold
Preliminary Size:356
Sequenced Size:413

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2021 2005-01-01 Successful iPCR screen
CG2021 2008-04-29 Release 5.5 accounting
CG2021 2008-08-15 Release 5.9 accounting
CG2021 2008-12-18 5.12 accounting

Clone Sequence Records

IP05684.complete Sequence

413 bp (413 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023632

> IP05684.complete
TCGCTAGCCTCTTGCCACAATTAGTATTTATTTTGTTCTGTTTGGAGAAG
TTATCAAGGAAAGACTGCTAAAATGTCCGGTCTGGAGTCGTATATCAATC
ACACAGTCTCCATCATTACGGCAGACGGACGGAACTTCATCGGGACACTC
AAGGGATTCGACCAGACCATCAATATCATCATAGACGAGTGCCATGAGCG
CGTCTTCTCTACCACCTCCGGCATCGAGCAAATCGTGCTGGGACTGCACA
TCATCCGGGGGGACAACATCGCGGTGATCGGACTGATAGACGAGACCATC
GACTCCCGCCTGGATTTGGCCAACATTAGGGGCGAGCCGCTGGGTCCCGT
GGTGCACTAGGATAGCGAATAAAACCAGTGATTCTCAAGACTTAAAAAAA
AAAAAAAAAAAAA

IP05684.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG2021-RA 395 CG2021-RA 1..395 1..395 1975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1776570..1776962 393..1 1965 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1777008..1777402 395..1 1975 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1777008..1777402 395..1 1975 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:03:39 has no hits.

IP05684.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:04:31 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1776570..1776962 1..393 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:03 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..288 73..360 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:14 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..288 73..360 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:03 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..288 73..360 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:44 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..288 73..360 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:57:12 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..288 73..360 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:14 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..354 40..393 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:14 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..354 40..393 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:03 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 10..402 1..393 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:44 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 1..354 40..393 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:57:12 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
CG2021-RA 10..402 1..393 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:31 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777010..1777402 1..393 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:31 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777010..1777402 1..393 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:31 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777010..1777402 1..393 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:03 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1777010..1777402 1..393 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:13 Download gff for IP05684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777010..1777402 1..393 100   Minus

IP05684.hyp Sequence

Translation from 72 to 359

> IP05684.hyp
MSGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSG
IEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGEPLGPVVH*

IP05684.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG2021-PA 95 CG2021-PA 1..95 1..95 482 100 Plus

IP05684.pep Sequence

Translation from 72 to 359

> IP05684.pep
MSGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHERVFSTTSG
IEQIVLGLHIIRGDNIAVIGLIDETIDSRLDLANIRGEPLGPVVH*

IP05684.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24963-PA 95 GF24963-PA 1..95 1..95 477 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14562-PA 95 GG14562-PA 1..95 1..95 477 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15765-PA 95 GH15765-PA 1..95 1..95 466 94.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG2021-PA 95 CG2021-PA 1..95 1..95 482 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12774-PA 95 GI12774-PA 1..95 1..95 471 97.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16212-PA 95 GL16212-PA 1..95 1..95 467 96.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15189-PA 95 GA15189-PA 1..95 1..95 467 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14170-PA 95 GM14170-PA 1..95 1..95 477 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13439-PA 95 GD13439-PA 1..95 1..95 477 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16072-PA 95 GJ16072-PA 1..95 1..95 471 97.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20525-PA 95 GK20525-PA 1..95 1..95 458 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20916-PA 95 GE20916-PA 1..95 1..95 477 100 Plus