Clone IP05686 Report

Search the DGRC for IP05686

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:86
Vector:pOT2
Associated Gene/TranscriptCG30093-RA
Protein status:IP05686.pep: gold
Preliminary Size:382
Sequenced Size:542

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30093 2005-01-01 Successful iPCR screen
CG30093 2008-04-29 Release 5.5 accounting
CG30093 2008-08-15 Release 5.9 accounting
CG30093 2008-12-18 5.12 accounting

Clone Sequence Records

IP05686.complete Sequence

542 bp (542 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023629

> IP05686.complete
TAGTATTCAAATTCAAGCTAGCTTAGCCATCCAGCCAGGCATCAGAATAA
GTCGAGTTATTGTGCAGATACATGCCGATCTTTGATATCCGGCTTATGGG
CAATATGCCCGCCAATACCGCTGGTCTGTGGAAGCGTGTCACCTTCCTGC
TGGCCCTACCGGCCATCGTCCTGTGCGCCGCAAACGCCTTCACCGGACAC
AAGCACGTGGAGCGGGAGCCGTTCGCCAAGTACGAGTACCTGAGGCGGCG
GACCAAACGATTCCCATGGGGAGATGGCAATCGCAGTTTGTTTCACAATG
CCGAGGTGAATGCCCTGCCCGAGGGCTACGAGGATGAGGTGGCTGAGGAG
GATTAAAAGCGCCTATTATTTTACTCTTTAACTTAGCTTACTACGAACTG
ATGGTAAGAAGTTCCCACTAAATGGAATGCCACCTAGATTTTTGGATAAA
CTTTATGATGACCAACTGCGATCGTTTGCCGATTCCTTGTCCGTAATAAA
TTAATCATTGAGATCTGAGTCAGTTAAAAAAAAAAAAAAAAA

IP05686.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-RA 525 CG30093-RA 1..525 1..525 2625 100 Plus
CG30093.a 529 CG30093.a 70..529 68..527 2300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11831312..11831836 1..525 2625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15944043..15944569 1..527 2635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15945242..15945768 1..527 2635 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:18:10 has no hits.

IP05686.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:18:48 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11831312..11831836 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:04 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 72..356 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:16 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 72..356 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:40:54 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 72..356 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:45 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 72..356 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:57:39 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 72..356 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:16 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:15 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:40:54 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 16..540 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:45 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:57:39 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 16..540 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:48 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15944043..15944567 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:48 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15944043..15944567 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:48 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15944043..15944567 1..525 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:40:54 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11831548..11832072 1..525 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:15 Download gff for IP05686.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15945242..15945766 1..525 100   Plus

IP05686.hyp Sequence

Translation from 71 to 355

> IP05686.hyp
MPIFDIRLMGNMPANTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREP
FAKYEYLRRRTKRFPWGDGNRSLFHNAEVNALPEGYEDEVAEED*

IP05686.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-PA 94 CG30093-PA 1..94 1..94 506 100 Plus
levy-PB 109 CG17280-PB 37..108 19..87 234 56.9 Plus
levy-PA 109 CG17280-PA 37..108 19..87 234 56.9 Plus
CG14077-PB 289 CG14077-PB 155..234 14..92 168 43.8 Plus
CG14077-PC 289 CG14077-PC 155..234 14..92 168 43.8 Plus

IP05686.pep Sequence

Translation from 71 to 355

> IP05686.pep
MPIFDIRLMGNMPANTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREP
FAKYEYLRRRTKRFPWGDGNRSLFHNAEVNALPEGYEDEVAEED*

IP05686.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11548-PA 97 GF11548-PA 8..85 6..83 337 78.2 Plus
Dana\GF13063-PA 109 GF13063-PA 37..108 19..87 231 56.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20553-PA 94 GG20553-PA 1..94 1..94 478 94.7 Plus
Dere\GG22865-PA 109 GG22865-PA 37..108 19..87 229 56.9 Plus
Dere\GG13442-PA 262 GG13442-PA 128..207 14..92 164 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22053-PA 103 GH22053-PA 32..102 19..87 241 63.4 Plus
Dgri\GH21206-PA 109 GH21206-PA 37..108 19..87 234 58.3 Plus
Dgri\GH15371-PA 323 GH15371-PA 113..187 20..93 164 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
COX6AL-PA 94 CG30093-PA 1..94 1..94 506 100 Plus
levy-PB 109 CG17280-PB 37..108 19..87 234 56.9 Plus
levy-PA 109 CG17280-PA 37..108 19..87 234 56.9 Plus
CG14077-PB 289 CG14077-PB 155..234 14..92 168 43.8 Plus
CG14077-PC 289 CG14077-PC 155..234 14..92 168 43.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19139-PA 102 GI19139-PA 23..101 9..87 246 62.5 Plus
Dmoj\GI20495-PA 109 GI20495-PA 37..108 19..87 240 59.7 Plus
Dmoj\GI12974-PA 218 GI12974-PA 1..72 19..90 185 48.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16869-PA 109 GL16869-PA 37..108 19..87 231 56.9 Plus
Dper\GL19037-PA 226 GL19037-PA 54..136 13..92 169 39.8 Plus
Dper\GL19036-PA 149 GL19036-PA 36..110 19..92 166 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14437-PA 109 GA14437-PA 37..108 19..87 231 56.9 Plus
Dpse\GA25318-PA 226 GA25318-PA 54..136 13..92 169 39.8 Plus
Dpse\GA25317-PA 221 GA25317-PA 108..182 19..92 164 41.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21645-PA 94 GM21645-PA 1..94 1..94 489 97.9 Plus
Dsec\GM16024-PA 109 GM16024-PA 37..108 19..87 231 56.9 Plus
Dsec\GM14911-PA 256 GM14911-PA 122..201 14..92 165 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11145-PA 94 GD11145-PA 1..94 1..94 492 98.9 Plus
Dsim\GD15452-PA 109 GD15452-PA 37..108 19..87 237 58.3 Plus
Dsim\CoVIa-PA 260 GD12318-PA 126..205 14..92 168 43.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22272-PA 102 GJ22272-PA 27..101 14..87 246 64 Plus
Dvir\GJ22345-PA 109 GJ22345-PA 37..108 19..87 238 58.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22192-PA 96 GK22192-PA 21..96 15..89 290 68.4 Plus
Dwil\GK23279-PA 109 GK23279-PA 37..108 19..87 229 56.9 Plus
Dwil\GK18134-PA 388 GK18134-PA 198..280 11..92 137 42.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11738-PA 94 GE11738-PA 1..94 1..94 478 94.7 Plus
Dyak\GE14301-PA 109 GE14301-PA 37..108 19..87 231 56.9 Plus
Dyak\GE22798-PA 262 GE22798-PA 128..207 14..92 166 42.5 Plus
Dyak\GE22540-PA 262 GE22540-PA 128..207 14..92 166 42.5 Plus