Clone IP05690 Report

Search the DGRC for IP05690

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:90
Vector:pOT2
Associated Gene/TranscriptCG30354-RA
Protein status:IP05690.pep: gold
Preliminary Size:316
Sequenced Size:397

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30354 2005-01-01 Successful iPCR screen
CG30354 2008-04-29 Release 5.5 accounting
CG30354 2008-08-15 Release 5.9 accounting
CG30354 2008-12-18 5.12 accounting

Clone Sequence Records

IP05690.complete Sequence

397 bp (397 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023630

> IP05690.complete
TGAGACACCCTAGCTCTCAGCCCAGAAATAAAAAACATATTTCGAACCTA
AGGAATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCCTCAAGGCCGATG
ATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTTAGGGAGAAGTGC
CAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTATCAAGAGTGCAA
TGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACATGCATGGAGGAAT
TGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCTCACAGTCTCTTC
TCGAAACTCAAATAGTTTCAAATTCTAGCAATGCTAAAAAAATAAAATTG
GCACTTAAATAAAGGAAACAAACTAAAACATAAAAAAAAAAAAAAAA

IP05690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-RA 403 CG30354-RA 23..403 1..381 1905 100 Plus
Ucrh-RD 513 Ucrh-RD 143..340 99..296 435 81.3 Plus
Ucrh-RC 617 Ucrh-RC 138..335 99..296 435 81.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4564909..4565243 47..381 1675 100 Plus
chr3LHet 2555433 chr3LHet 606499..606654 141..296 345 81.4 Plus
chr2R 21145070 chr2R 4564807..4564852 1..46 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8677327..8677664 47..384 1690 100 Plus
3L 28110227 3L 25121043..25121198 141..296 345 81.4 Plus
2R 25286936 2R 8677225..8677270 1..46 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8678526..8678863 47..384 1690 100 Plus
3L 28103327 3L 25114143..25114298 141..296 345 81.4 Plus
2R 25260384 2R 8678424..8678469 1..46 230 100 Plus
Blast to na_te.dros performed 2019-03-16 23:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 7252..7297 380..335 113 71.7 Minus

IP05690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:26:48 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4564807..4564852 1..46 100 -> Plus
chr2R 4564909..4565243 47..381 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:07 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 55..315 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:17 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 55..315 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:43 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 55..315 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:46 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 55..315 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:49:31 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..261 55..315 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:18 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..316 47..362 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:17 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..381 1..381 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:43 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 7..387 1..381 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:46 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 1..316 47..362 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:49:31 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
CG30354-RA 7..387 1..381 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:48 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8677225..8677270 1..46 100 -> Plus
2R 8677327..8677661 47..381 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:48 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8677225..8677270 1..46 100 -> Plus
2R 8677327..8677661 47..381 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:48 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8677225..8677270 1..46 100 -> Plus
2R 8677327..8677661 47..381 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:43 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4564730..4564775 1..46 100 -> Plus
arm_2R 4564832..4565166 47..381 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:16 Download gff for IP05690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8678526..8678860 47..381 100   Plus
2R 8678424..8678469 1..46 100 -> Plus

IP05690.pep Sequence

Translation from 54 to 314

> IP05690.pep
MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND
RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*

IP05690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23099-PA 84 GF23099-PA 7..84 8..86 351 81 Plus
Dana\GF18375-PA 98 GF18375-PA 33..98 21..86 291 81.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11966-PA 85 GG11966-PA 1..85 1..86 369 79.1 Plus
Dere\GG23376-PA 820 GG23376-PA 62..137 1..76 359 86.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22364-PA 86 GH22364-PA 1..86 1..86 360 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-11L-PB 86 CG30354-PB 1..86 1..86 450 100 Plus
UQCR-11L-PA 86 CG30354-PA 1..86 1..86 450 100 Plus
UQCR-11-PD 85 CG41623-PD 1..85 1..86 360 77.9 Plus
UQCR-11-PC 85 CG41623-PC 1..85 1..86 360 77.9 Plus
UQCR-11-PB 85 CG41623-PB 1..85 1..86 360 77.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23618-PA 86 GI23618-PA 1..86 1..86 379 82.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12348-PA 77 GL12348-PA 1..77 9..86 367 88.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Ucrh-PA 85 GA27479-PA 1..85 1..86 384 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18768-PA 85 GM18768-PA 1..85 1..86 363 76.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11930-PA 85 GD11930-PA 1..85 1..86 363 76.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23592-PA 86 GJ23592-PA 1..86 1..86 392 86 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14352-PA 86 GK14352-PA 1..86 1..86 376 79.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25384-PA 85 GE25384-PA 1..85 1..86 365 77.9 Plus

IP05690.hyp Sequence

Translation from 54 to 314

> IP05690.hyp
MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND
RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*

IP05690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG30354-PB 86 CG30354-PB 1..86 1..86 450 100 Plus
CG30354-PA 86 CG30354-PA 1..86 1..86 450 100 Plus
Ucrh-PD 85 CG41623-PD 1..85 1..86 360 77.9 Plus
Ucrh-PC 85 CG41623-PC 1..85 1..86 360 77.9 Plus
Ucrh-PB 85 CG41623-PB 1..85 1..86 360 77.9 Plus