![]() | BDGP Sequence Production Resources |
Search the DGRC for IP05690
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 56 |
Well: | 90 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30354-RA |
Protein status: | IP05690.pep: gold |
Preliminary Size: | 316 |
Sequenced Size: | 397 |
Gene | Date | Evidence |
---|---|---|
CG30354 | 2005-01-01 | Successful iPCR screen |
CG30354 | 2008-04-29 | Release 5.5 accounting |
CG30354 | 2008-08-15 | Release 5.9 accounting |
CG30354 | 2008-12-18 | 5.12 accounting |
397 bp (397 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023630
> IP05690.complete TGAGACACCCTAGCTCTCAGCCCAGAAATAAAAAACATATTTCGAACCTA AGGAATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCCTCAAGGCCGATG ATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTTAGGGAGAAGTGC CAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTATCAAGAGTGCAA TGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACATGCATGGAGGAAT TGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCTCACAGTCTCTTC TCGAAACTCAAATAGTTTCAAATTCTAGCAATGCTAAAAAAATAAAATTG GCACTTAAATAAAGGAAACAAACTAAAACATAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 4564909..4565243 | 47..381 | 1675 | 100 | Plus |
chr3LHet | 2555433 | chr3LHet | 606499..606654 | 141..296 | 345 | 81.4 | Plus |
chr2R | 21145070 | chr2R | 4564807..4564852 | 1..46 | 230 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord2 | 7650 | accord2 QBERT 7650bp | 7252..7297 | 380..335 | 113 | 71.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4564807..4564852 | 1..46 | 100 | -> | Plus |
chr2R | 4564909..4565243 | 47..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..261 | 55..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..261 | 55..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..261 | 55..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..261 | 55..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..261 | 55..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..316 | 47..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..381 | 1..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 7..387 | 1..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 1..316 | 47..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30354-RA | 7..387 | 1..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8677225..8677270 | 1..46 | 100 | -> | Plus |
2R | 8677327..8677661 | 47..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8677225..8677270 | 1..46 | 100 | -> | Plus |
2R | 8677327..8677661 | 47..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8677225..8677270 | 1..46 | 100 | -> | Plus |
2R | 8677327..8677661 | 47..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4564730..4564775 | 1..46 | 100 | -> | Plus |
arm_2R | 4564832..4565166 | 47..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8678526..8678860 | 47..381 | 100 | Plus | |
2R | 8678424..8678469 | 1..46 | 100 | -> | Plus |
Translation from 54 to 314
> IP05690.pep MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23099-PA | 84 | GF23099-PA | 7..84 | 8..86 | 351 | 81 | Plus |
Dana\GF18375-PA | 98 | GF18375-PA | 33..98 | 21..86 | 291 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11966-PA | 85 | GG11966-PA | 1..85 | 1..86 | 369 | 79.1 | Plus |
Dere\GG23376-PA | 820 | GG23376-PA | 62..137 | 1..76 | 359 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22364-PA | 86 | GH22364-PA | 1..86 | 1..86 | 360 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
UQCR-11L-PB | 86 | CG30354-PB | 1..86 | 1..86 | 450 | 100 | Plus |
UQCR-11L-PA | 86 | CG30354-PA | 1..86 | 1..86 | 450 | 100 | Plus |
UQCR-11-PD | 85 | CG41623-PD | 1..85 | 1..86 | 360 | 77.9 | Plus |
UQCR-11-PC | 85 | CG41623-PC | 1..85 | 1..86 | 360 | 77.9 | Plus |
UQCR-11-PB | 85 | CG41623-PB | 1..85 | 1..86 | 360 | 77.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23618-PA | 86 | GI23618-PA | 1..86 | 1..86 | 379 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12348-PA | 77 | GL12348-PA | 1..77 | 9..86 | 367 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Ucrh-PA | 85 | GA27479-PA | 1..85 | 1..86 | 384 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18768-PA | 85 | GM18768-PA | 1..85 | 1..86 | 363 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11930-PA | 85 | GD11930-PA | 1..85 | 1..86 | 363 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23592-PA | 86 | GJ23592-PA | 1..86 | 1..86 | 392 | 86 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14352-PA | 86 | GK14352-PA | 1..86 | 1..86 | 376 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25384-PA | 85 | GE25384-PA | 1..85 | 1..86 | 365 | 77.9 | Plus |
Translation from 54 to 314
> IP05690.hyp MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30354-PB | 86 | CG30354-PB | 1..86 | 1..86 | 450 | 100 | Plus |
CG30354-PA | 86 | CG30354-PA | 1..86 | 1..86 | 450 | 100 | Plus |
Ucrh-PD | 85 | CG41623-PD | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PC | 85 | CG41623-PC | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PB | 85 | CG41623-PB | 1..85 | 1..86 | 360 | 77.9 | Plus |