Clone IP05691 Report

Search the DGRC for IP05691

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:91
Vector:pOT2
Associated Gene/TranscriptCG30380-RA
Protein status:IP05691.pep: gold
Preliminary Size:306
Sequenced Size:456

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30380 2005-01-01 Successful iPCR screen
CG30380 2008-04-29 Release 5.5 accounting
CG30380 2008-08-15 Release 5.9 accounting
CG30380 2008-12-18 5.12 accounting

Clone Sequence Records

IP05691.complete Sequence

456 bp assembled on 2006-11-09

GenBank Submission: BT023627

> IP05691.complete
GCACACGAAGTCGGACTTAAACGGGTTCCGTCAGCTAAAAGTAAAAGTTA
ATTGCCCGCGTGTGAGTGCAATTGTGCGATAATGAGCGTAACTGCGCTAT
TGCTCAAGGCTTTGTTTGTGCTCGGGCTGACCGTACTTTCGGGACCAGGA
AGAGTGGCTGCCTACGATCCCAATGATCCTAAGATAGCCGAGTGCTGCCT
GCCACCGGAGGGGATGTTCGAGGCCTTTTATCCCCGTGAGGTGGAGGGAA
TCCCCAATAGCGCATCGCGACCCGCACACGGACATGGCAGCTTCTTCAAG
CACCGGAACCCAGCGCTAGTGGACACCAAGAACGCGGCGGCCTATGGCTA
TAGGTTCGACGGCAAGAGGCGTTTCAACTTCGATTAGTTCCGCTTTTAAA
ATCTGTATTATTCGCAAATAAAGCCCCTTTTTGAAAACGAAAAAAAAAAA
AAAAAA

IP05691.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30380-RA 439 CG30380-RA 1..439 1..439 2195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3826594..3827032 439..1 2165 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7939197..7939639 443..1 2215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7940396..7940838 443..1 2215 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:11:29 has no hits.

IP05691.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:12:17 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3826594..3827032 1..439 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:08 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..306 82..387 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:51 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..306 82..387 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:54 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..306 82..387 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:28 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..306 82..387 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:20 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..306 82..387 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:11 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..439 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:51 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..439 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:54 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 21..459 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:29 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 1..439 1..439 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:20 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
CG30380-RA 21..459 1..439 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:17 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7939201..7939639 1..439 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:17 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7939201..7939639 1..439 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:17 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7939201..7939639 1..439 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:54 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3826706..3827144 1..439 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:05 Download gff for IP05691.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7940400..7940838 1..439 100   Minus

IP05691.hyp Sequence

Translation from 81 to 386

> IP05691.hyp
MSVTALLLKALFVLGLTVLSGPGRVAAYDPNDPKIAECCLPPEGMFEAFY
PREVEGIPNSASRPAHGHGSFFKHRNPALVDTKNAAAYGYRFDGKRRFNF
D*

IP05691.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30380-PA 101 CG30380-PA 1..101 1..101 541 100 Plus

IP05691.pep Sequence

Translation from 81 to 386

> IP05691.pep
MSVTALLLKALFVLGLTVLSGPGRVAAYDPNDPKIAECCLPPEGMFEAFY
PREVEGIPNSASRPAHGHGSFFKHRNPALVDTKNAAAYGYRFDGKRRFNF
D*

IP05691.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11229-PA 99 GF11229-PA 1..99 1..101 436 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10695-PA 101 GG10695-PA 1..101 1..101 505 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20580-PA 57 GH20580-PA 1..57 45..101 301 100 Plus
Dgri\GH20582-PA 57 GH20582-PA 1..57 45..101 288 96.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG30380-PA 101 CG30380-PA 1..101 1..101 541 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19727-PA 100 GI19727-PA 1..100 1..101 412 79.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10383-PA 100 GL10383-PA 1..100 1..101 409 79.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15803-PA 100 GA15803-PA 1..100 1..101 409 79.2 Plus
Dpse\GA24958-PA 100 GA24958-PA 1..100 1..101 409 79.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20743-PA 102 GM20743-PA 16..102 15..101 451 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10209-PA 57 GD10209-PA 1..57 45..101 301 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14965-PA 57 GJ14965-PA 1..57 45..101 301 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21347-PA 82 GK21347-PA 6..82 25..101 392 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23487-PA 101 GE23487-PA 1..101 1..101 446 91.1 Plus