Clone IP05715 Report

Search the DGRC for IP05715

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:15
Vector:pOT2
Associated Gene/TranscriptCG14631-RA
Protein status:IP05715.pep: gold
Preliminary Size:399
Sequenced Size:607

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14631 2005-01-01 Successful iPCR screen
CG14631 2008-04-29 Release 5.5 accounting
CG14631 2008-08-15 Release 5.9 accounting
CG14631 2008-12-18 5.12 accounting

Clone Sequence Records

IP05715.complete Sequence

607 bp (607 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023625

> IP05715.complete
ATTCAGAATAAACTTTGCTACTAGCTCCCCAAAATACTTGTGAATTAGAA
ACTTTGAAAAATTACATAAAACTCGAACATGGATGATTTGGCTAACGAGT
ACACCGGCAGTGAAGAGAGGAGTGGAGAAGCCTCCAAGCTCGGACTCCTG
GCCAGGGTGGACCGTCTGCTCCGGCGCTGGCTGCCTGGATACAGCTTCAT
TCGCGGCAAGCGTCTCTCGACATCGGAAACCTCGATCGTGCACGGCTGCT
CCCACGGCACACAGGCGGTGCGTGGACGTGGTGACCGGATGAATAATAAG
GAGGAGGTGTACCTGGACACCGGCATCGCCAAGTCGGAGTTCTGCGTCCA
CCTGGAGACCTTGCTGCGCAACAAGCTGCTCAAGAAGCAGCAGGAATTGG
CCCTGGAACATCAGGAGAGAAGCCGCGAGATGGAGCTGGAGCAGGAACGG
CAGCTCAATCAACAAGTTCAGCAGTAGGAAAGTCTACCTATTGTGTTATT
TTTCACTTCAATTGTGTATATATATTTTTAATACCATCAATCAGTCGTGG
CGAGGCGAGGCGAGGCGCCTCATTAAAATTAATTAAAAATAAAAAAAAAA
AAAAAAA

IP05715.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14631-RA 592 CG14631-RA 1..592 1..592 2960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 906005..906589 1..590 2825 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1012035..1012626 1..592 2960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1020133..1020724 1..592 2960 100 Plus
Blast to na_te.dros performed 2019-03-16 15:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy10 6006 gypsy10 GYPSY10 6006bp 2302..2348 35..79 112 76.6 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3289..3335 431..477 109 70.2 Plus

IP05715.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:08:57 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 906005..906566 1..562 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:12 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..399 79..477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:20 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..399 79..477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:40:45 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..399 79..477 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:48 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..399 79..477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:38 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..399 79..477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:22 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:19 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:40:45 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:48 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:38 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
CG14631-RA 1..590 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:57 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
X 1012035..1012624 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:57 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
X 1012035..1012624 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:57 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
X 1012035..1012624 1..590 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:40:45 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 906068..906657 1..590 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:19 Download gff for IP05715.complete
Subject Subject Range Query Range Percent Splice Strand
X 1020133..1020722 1..590 100   Plus

IP05715.hyp Sequence

Translation from 78 to 476

> IP05715.hyp
MDDLANEYTGSEERSGEASKLGLLARVDRLLRRWLPGYSFIRGKRLSTSE
TSIVHGCSHGTQAVRGRGDRMNNKEEVYLDTGIAKSEFCVHLETLLRNKL
LKKQQELALEHQERSREMELEQERQLNQQVQQ*

IP05715.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14631-PA 132 CG14631-PA 1..132 1..132 673 100 Plus

IP05715.pep Sequence

Translation from 78 to 476

> IP05715.pep
MDDLANEYTGSEERSGEASKLGLLARVDRLLRRWLPGYSFIRGKRLSTSE
TSIVHGCSHGTQAVRGRGDRMNNKEEVYLDTGIAKSEFCVHLETLLRNKL
LKKQQELALEHQERSREMELEQERQLNQQVQQ*

IP05715.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22122-PA 154 GF22122-PA 21..154 15..131 172 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13058-PA 134 GG13058-PA 1..111 1..111 346 76.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14631-PA 132 CG14631-PA 1..132 1..132 673 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14216-PA 211 GL14216-PA 96..211 21..112 142 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13130-PA 274 GA13130-PA 161..274 23..112 147 32.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19107-PA 128 GM19107-PA 1..128 1..132 575 87.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24706-PA 128 GD24706-PA 1..128 1..132 577 88.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10166-PA 155 GK10166-PA 35..149 14..106 136 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16654-PA 132 GE16654-PA 1..131 1..131 392 75.2 Plus