BDGP Sequence Production Resources |
Search the DGRC for IP05728
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 57 |
Well: | 28 |
Vector: | pOT2 |
Associated Gene/Transcript | Trissin-RB |
Protein status: | IP05728.pep: gold |
Preliminary Size: | 327 |
Sequenced Size: | 593 |
Gene | Date | Evidence |
---|---|---|
CG14871 | 2005-01-01 | Successful iPCR screen |
CG14871 | 2008-04-29 | Release 5.5 accounting |
CG14871 | 2008-08-15 | Release 5.9 accounting |
CG14871 | 2008-12-18 | 5.12 accounting |
593 bp (593 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022438
> IP05728.complete GACACCAAGCGAAGATCATATGAGTGGCACAGCATTCTGAGCAGACGGCC GACCAATGACTAAGACAACGATGCATTGGCTGGCTCACTTCCAGATCATC TTGCTATGCATTTGGTTGATGTGCCCCCCCAGTTCGCAGGCCATAAAATG CGACACTTGTGGCAAGGAGTGTGCCAGCGCATGTGGCACAAAGCACTTTC GCACATGCTGCTTTAACTACCTTCGCAAGCGATCCGACCCCGATGCACTG CGTCAGAGCTCGAACAGGAGGCTCATCGACTTCATACTGCTGCAGGGGCG TGCCCTCTTCACCCAGGAGTTGCGAGAAAGGCGCCACAATGGCACATTGA TGGACCTCGGCCTGAACACCTACTACCCCTAAGGATATCCCCAGATGAAC CAACTTGGACTGACACCAAAACTGGCAACGACTTCGATTAACGAACTATG TGATCCAATGGCTATGGCAAATGGTTGAAATGCTTGAAATGTTACTTACC AATAAAGGCACAAACTTCTTTGGGGCACTGTGCTTGATTAAAGCACAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14871-RB | 621 | CG14871-RB | 63..609 | 1..547 | 2735 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11309433..11309778 | 546..201 | 1700 | 99.4 | Minus |
chr3R | 27901430 | chr3R | 11309987..11310094 | 108..1 | 540 | 100 | Minus |
chr3R | 27901430 | chr3R | 11309832..11309925 | 201..108 | 470 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15484729..15485075 | 547..201 | 1735 | 100 | Minus |
3R | 32079331 | 3R | 15485284..15485391 | 108..1 | 540 | 100 | Minus |
3R | 32079331 | 3R | 15485129..15485222 | 201..108 | 470 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 15225560..15225906 | 547..201 | 1735 | 100 | Minus |
3R | 31820162 | 3R | 15226115..15226222 | 108..1 | 540 | 100 | Minus |
3R | 31820162 | 3R | 15225960..15226053 | 201..108 | 470 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader6 | 4885 | invader6 INVADER6 4885bp | 726..757 | 296..265 | 106 | 81.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11309433..11309777 | 202..546 | 99 | <- | Minus |
chr3R | 11309832..11309925 | 108..201 | 100 | <- | Minus |
chr3R | 11309988..11310094 | 1..107 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RB | 1..327 | 56..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RB | 1..327 | 56..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Trissin-RB | 1..327 | 56..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RA | 78..327 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Trissin-RB | 1..327 | 56..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RB | 6..551 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RB | 6..551 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Trissin-RB | 6..551 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14871-RA | 78..327 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Trissin-RB | 6..551 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15484730..15485074 | 202..546 | 100 | <- | Minus |
3R | 15485129..15485222 | 108..201 | 100 | <- | Minus |
3R | 15485285..15485391 | 1..107 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15484730..15485074 | 202..546 | 100 | <- | Minus |
3R | 15485129..15485222 | 108..201 | 100 | <- | Minus |
3R | 15485285..15485391 | 1..107 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15484730..15485074 | 202..546 | 100 | <- | Minus |
3R | 15485129..15485222 | 108..201 | 100 | <- | Minus |
3R | 15485285..15485391 | 1..107 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11310452..11310796 | 202..546 | 100 | <- | Minus |
arm_3R | 11310851..11310944 | 108..201 | 100 | <- | Minus |
arm_3R | 11311007..11311113 | 1..107 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15225561..15225905 | 202..546 | 100 | <- | Minus |
3R | 15225960..15226053 | 108..201 | 100 | <- | Minus |
3R | 15226116..15226222 | 1..107 | 100 | Minus |
Translation from 55 to 381
> IP05728.pep MTKTTMHWLAHFQIILLCIWLMCPPSSQAIKCDTCGKECASACGTKHFRT CCFNYLRKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMD LGLNTYYP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16698-PA | 114 | GF16698-PA | 29..113 | 23..107 | 393 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20497-PA | 114 | GG20497-PA | 33..113 | 27..107 | 429 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18511-PA | 99 | GH18511-PA | 2..98 | 11..107 | 362 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Trissin-PB | 108 | CG14871-PB | 1..108 | 1..108 | 597 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24353-PA | 87 | GI24353-PA | 1..86 | 22..107 | 387 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23785-PA | 88 | GL23785-PA | 4..87 | 26..107 | 361 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13311-PA | 104 | GA13311-PA | 1..103 | 6..107 | 448 | 83.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25767-PA | 113 | GM25767-PA | 30..113 | 25..108 | 446 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20345-PA | 106 | GD20345-PA | 24..106 | 26..108 | 440 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24365-PA | 99 | GJ24365-PA | 2..99 | 11..108 | 405 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11631-PA | 104 | GK11631-PA | 3..103 | 7..107 | 460 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26371-PA | 107 | GE26371-PA | 25..106 | 26..107 | 431 | 97.6 | Plus |
Translation from 55 to 381
> IP05728.hyp MTKTTMHWLAHFQIILLCIWLMCPPSSQAIKCDTCGKECASACGTKHFRT CCFNYLRKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMD LGLNTYYP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Trissin-PB | 108 | CG14871-PB | 1..108 | 1..108 | 597 | 100 | Plus |