Clone IP05728 Report

Search the DGRC for IP05728

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:28
Vector:pOT2
Associated Gene/TranscriptTrissin-RB
Protein status:IP05728.pep: gold
Preliminary Size:327
Sequenced Size:593

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14871 2005-01-01 Successful iPCR screen
CG14871 2008-04-29 Release 5.5 accounting
CG14871 2008-08-15 Release 5.9 accounting
CG14871 2008-12-18 5.12 accounting

Clone Sequence Records

IP05728.complete Sequence

593 bp (593 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022438

> IP05728.complete
GACACCAAGCGAAGATCATATGAGTGGCACAGCATTCTGAGCAGACGGCC
GACCAATGACTAAGACAACGATGCATTGGCTGGCTCACTTCCAGATCATC
TTGCTATGCATTTGGTTGATGTGCCCCCCCAGTTCGCAGGCCATAAAATG
CGACACTTGTGGCAAGGAGTGTGCCAGCGCATGTGGCACAAAGCACTTTC
GCACATGCTGCTTTAACTACCTTCGCAAGCGATCCGACCCCGATGCACTG
CGTCAGAGCTCGAACAGGAGGCTCATCGACTTCATACTGCTGCAGGGGCG
TGCCCTCTTCACCCAGGAGTTGCGAGAAAGGCGCCACAATGGCACATTGA
TGGACCTCGGCCTGAACACCTACTACCCCTAAGGATATCCCCAGATGAAC
CAACTTGGACTGACACCAAAACTGGCAACGACTTCGATTAACGAACTATG
TGATCCAATGGCTATGGCAAATGGTTGAAATGCTTGAAATGTTACTTACC
AATAAAGGCACAAACTTCTTTGGGGCACTGTGCTTGATTAAAGCACAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP05728.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14871-RB 621 CG14871-RB 63..609 1..547 2735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11309433..11309778 546..201 1700 99.4 Minus
chr3R 27901430 chr3R 11309987..11310094 108..1 540 100 Minus
chr3R 27901430 chr3R 11309832..11309925 201..108 470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15484729..15485075 547..201 1735 100 Minus
3R 32079331 3R 15485284..15485391 108..1 540 100 Minus
3R 32079331 3R 15485129..15485222 201..108 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15225560..15225906 547..201 1735 100 Minus
3R 31820162 3R 15226115..15226222 108..1 540 100 Minus
3R 31820162 3R 15225960..15226053 201..108 470 100 Minus
Blast to na_te.dros performed 2019-03-16 03:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
invader6 4885 invader6 INVADER6 4885bp 726..757 296..265 106 81.2 Minus

IP05728.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:41 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11309433..11309777 202..546 99 <- Minus
chr3R 11309832..11309925 108..201 100 <- Minus
chr3R 11309988..11310094 1..107 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:13 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RB 1..327 56..382 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:20 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RB 1..327 56..382 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:07 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
Trissin-RB 1..327 56..382 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:02 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RA 78..327 133..382 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
Trissin-RB 1..327 56..382 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:02:51 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RB 6..551 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:20 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RB 6..551 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:07 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
Trissin-RB 6..551 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:02 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
CG14871-RA 78..327 133..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
Trissin-RB 6..551 1..546 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:41 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15484730..15485074 202..546 100 <- Minus
3R 15485129..15485222 108..201 100 <- Minus
3R 15485285..15485391 1..107 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:41 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15484730..15485074 202..546 100 <- Minus
3R 15485129..15485222 108..201 100 <- Minus
3R 15485285..15485391 1..107 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:41 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15484730..15485074 202..546 100 <- Minus
3R 15485129..15485222 108..201 100 <- Minus
3R 15485285..15485391 1..107 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:07 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11310452..11310796 202..546 100 <- Minus
arm_3R 11310851..11310944 108..201 100 <- Minus
arm_3R 11311007..11311113 1..107 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:13 Download gff for IP05728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15225561..15225905 202..546 100 <- Minus
3R 15225960..15226053 108..201 100 <- Minus
3R 15226116..15226222 1..107 100   Minus

IP05728.pep Sequence

Translation from 55 to 381

> IP05728.pep
MTKTTMHWLAHFQIILLCIWLMCPPSSQAIKCDTCGKECASACGTKHFRT
CCFNYLRKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMD
LGLNTYYP*

IP05728.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16698-PA 114 GF16698-PA 29..113 23..107 393 85.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20497-PA 114 GG20497-PA 33..113 27..107 429 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18511-PA 99 GH18511-PA 2..98 11..107 362 75.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Trissin-PB 108 CG14871-PB 1..108 1..108 597 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24353-PA 87 GI24353-PA 1..86 22..107 387 82.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23785-PA 88 GL23785-PA 4..87 26..107 361 82.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13311-PA 104 GA13311-PA 1..103 6..107 448 83.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25767-PA 113 GM25767-PA 30..113 25..108 446 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20345-PA 106 GD20345-PA 24..106 26..108 440 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24365-PA 99 GJ24365-PA 2..99 11..108 405 78.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11631-PA 104 GK11631-PA 3..103 7..107 460 84.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26371-PA 107 GE26371-PA 25..106 26..107 431 97.6 Plus

IP05728.hyp Sequence

Translation from 55 to 381

> IP05728.hyp
MTKTTMHWLAHFQIILLCIWLMCPPSSQAIKCDTCGKECASACGTKHFRT
CCFNYLRKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMD
LGLNTYYP*

IP05728.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Trissin-PB 108 CG14871-PB 1..108 1..108 597 100 Plus