Clone IP05733 Report

Search the DGRC for IP05733

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:33
Vector:pOT2
Associated Gene/TranscriptCG15152-RA
Protein status:IP05733.pep: gold
Preliminary Size:339
Sequenced Size:576

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15152 2005-01-01 Successful iPCR screen
CG15152 2008-04-29 Release 5.5 accounting
CG15152 2008-08-15 Release 5.9 accounting
CG15152 2008-12-18 5.12 accounting

Clone Sequence Records

IP05733.complete Sequence

576 bp (576 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023626

> IP05733.complete
CAGAACGCGTTTTGAAATGGACACGGATGAGACTAAGGCTGGAACCTCGG
GTCCGGGGACGTACCACGATGAGGTTGACTTTACCAGCGGATACGAGACT
CAGTATAAGAAGGAGTACAGCCCGCTGAAACCGATTTTTGTACCGCCGCC
GGATAAAAAGCACGCCTGGTTTCGCAACTGGTCCACCATACTGATGGTCA
GCTTCCTGTCCGGGGTGTTTATTCTGGGAACCGTGATGCTGGTGGTCCAA
GTTTTCACCGCCAGTCCCCTGCAGATCTTCATGATCGTGGCTATATATGT
GGCTATAGCCGCTGTGATGATTTGGCTGGAGGTGCAGTCTATAAAAGTGC
GGTGAAATAATATGTACGTGTCGTGACTAATTTAGAGCGTTATCGCACTT
ACGAGCTACGTTCTGTTTTCAAACAGTGGCAATCGAACTGTGTTCTGCTA
GCAAATGCAAAGCTTAACTAAAAAGGAAGCGGCTTTACTGATTAGGCGCT
AAGAACAAAAAATCATGATTTAATATAAGTTCAAAGTAAAGAAAGAAATC
CCATAAAAAAAAAAAAAAAAAAAAAA

IP05733.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15152-RA 674 CG15152-RA 121..674 1..554 2770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18113324..18113877 1..554 2770 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18114667..18115222 1..556 2780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18114667..18115222 1..556 2780 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:02:42 has no hits.

IP05733.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:03:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18113324..18113877 1..554 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:14 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:21 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:46:13 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:35 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:25 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 121..674 1..554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:21 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 121..674 1..554 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:46:13 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 121..674 1..554 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 121..674 1..554 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:35 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
CG15152-RA 121..674 1..554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18114667..18115220 1..554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18114667..18115220 1..554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:49 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18114667..18115220 1..554 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:46:13 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18114667..18115220 1..554 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:20 Download gff for IP05733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18114667..18115220 1..554 100   Plus

IP05733.hyp Sequence

Translation from 0 to 354

> IP05733.hyp
RTRFEMDTDETKAGTSGPGTYHDEVDFTSGYETQYKKEYSPLKPIFVPPP
DKKHAWFRNWSTILMVSFLSGVFILGTVMLVVQVFTASPLQIFMIVAIYV
AIAAVMIWLEVQSIKVR*

IP05733.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15152-PB 112 CG15152-PB 1..112 6..117 583 100 Plus
CG15152-PA 112 CG15152-PA 1..112 6..117 583 100 Plus

IP05733.pep Sequence

Translation from 16 to 354

> IP05733.pep
MDTDETKAGTSGPGTYHDEVDFTSGYETQYKKEYSPLKPIFVPPPDKKHA
WFRNWSTILMVSFLSGVFILGTVMLVVQVFTASPLQIFMIVAIYVAIAAV
MIWLEVQSIKVR*

IP05733.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14815-PA 112 GF14815-PA 1..112 1..112 454 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21107-PA 112 GG21107-PA 1..112 1..112 526 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23899-PA 113 GH23899-PA 1..112 1..111 399 65.2 Plus
Dgri\GH11639-PA 113 GH11639-PA 1..112 1..111 399 65.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15152-PB 112 CG15152-PB 1..112 1..112 583 100 Plus
CG15152-PA 112 CG15152-PA 1..112 1..112 583 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17940-PA 112 GI17940-PA 1..112 1..112 417 67.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14686-PA 113 GL14686-PA 1..113 1..112 382 73.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13533-PA 113 GA13533-PA 1..113 1..112 379 71.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17265-PA 112 GM17265-PA 1..112 1..112 571 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24130-PA 112 GD24130-PA 1..112 1..112 571 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17712-PA 112 GJ17712-PA 1..112 1..112 423 67 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18905-PA 115 GK18905-PA 1..115 1..112 351 56.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12813-PA 112 GE12813-PA 1..112 1..112 580 97.3 Plus