BDGP Sequence Production Resources |
Search the DGRC for IP05733
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 57 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15152-RA |
Protein status: | IP05733.pep: gold |
Preliminary Size: | 339 |
Sequenced Size: | 576 |
Gene | Date | Evidence |
---|---|---|
CG15152 | 2005-01-01 | Successful iPCR screen |
CG15152 | 2008-04-29 | Release 5.5 accounting |
CG15152 | 2008-08-15 | Release 5.9 accounting |
CG15152 | 2008-12-18 | 5.12 accounting |
576 bp (576 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023626
> IP05733.complete CAGAACGCGTTTTGAAATGGACACGGATGAGACTAAGGCTGGAACCTCGG GTCCGGGGACGTACCACGATGAGGTTGACTTTACCAGCGGATACGAGACT CAGTATAAGAAGGAGTACAGCCCGCTGAAACCGATTTTTGTACCGCCGCC GGATAAAAAGCACGCCTGGTTTCGCAACTGGTCCACCATACTGATGGTCA GCTTCCTGTCCGGGGTGTTTATTCTGGGAACCGTGATGCTGGTGGTCCAA GTTTTCACCGCCAGTCCCCTGCAGATCTTCATGATCGTGGCTATATATGT GGCTATAGCCGCTGTGATGATTTGGCTGGAGGTGCAGTCTATAAAAGTGC GGTGAAATAATATGTACGTGTCGTGACTAATTTAGAGCGTTATCGCACTT ACGAGCTACGTTCTGTTTTCAAACAGTGGCAATCGAACTGTGTTCTGCTA GCAAATGCAAAGCTTAACTAAAAAGGAAGCGGCTTTACTGATTAGGCGCT AAGAACAAAAAATCATGATTTAATATAAGTTCAAAGTAAAGAAAGAAATC CCATAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15152-RA | 674 | CG15152-RA | 121..674 | 1..554 | 2770 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18113324..18113877 | 1..554 | 2770 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18114667..18115222 | 1..556 | 2780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18114667..18115222 | 1..556 | 2780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18113324..18113877 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 1..339 | 17..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 1..339 | 17..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 1..339 | 17..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 1..339 | 17..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 1..339 | 17..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 121..674 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 121..674 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 121..674 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 121..674 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15152-RA | 121..674 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18114667..18115220 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18114667..18115220 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18114667..18115220 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18114667..18115220 | 1..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18114667..18115220 | 1..554 | 100 | Plus |
Translation from 0 to 354
> IP05733.hyp RTRFEMDTDETKAGTSGPGTYHDEVDFTSGYETQYKKEYSPLKPIFVPPP DKKHAWFRNWSTILMVSFLSGVFILGTVMLVVQVFTASPLQIFMIVAIYV AIAAVMIWLEVQSIKVR*
Translation from 16 to 354
> IP05733.pep MDTDETKAGTSGPGTYHDEVDFTSGYETQYKKEYSPLKPIFVPPPDKKHA WFRNWSTILMVSFLSGVFILGTVMLVVQVFTASPLQIFMIVAIYVAIAAV MIWLEVQSIKVR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14815-PA | 112 | GF14815-PA | 1..112 | 1..112 | 454 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21107-PA | 112 | GG21107-PA | 1..112 | 1..112 | 526 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23899-PA | 113 | GH23899-PA | 1..112 | 1..111 | 399 | 65.2 | Plus |
Dgri\GH11639-PA | 113 | GH11639-PA | 1..112 | 1..111 | 399 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15152-PB | 112 | CG15152-PB | 1..112 | 1..112 | 583 | 100 | Plus |
CG15152-PA | 112 | CG15152-PA | 1..112 | 1..112 | 583 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17940-PA | 112 | GI17940-PA | 1..112 | 1..112 | 417 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14686-PA | 113 | GL14686-PA | 1..113 | 1..112 | 382 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13533-PA | 113 | GA13533-PA | 1..113 | 1..112 | 379 | 71.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17265-PA | 112 | GM17265-PA | 1..112 | 1..112 | 571 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24130-PA | 112 | GD24130-PA | 1..112 | 1..112 | 571 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17712-PA | 112 | GJ17712-PA | 1..112 | 1..112 | 423 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18905-PA | 115 | GK18905-PA | 1..115 | 1..112 | 351 | 56.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12813-PA | 112 | GE12813-PA | 1..112 | 1..112 | 580 | 97.3 | Plus |