BDGP Sequence Production Resources |
Search the DGRC for IP05750
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 57 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15434-RA |
Protein status: | IP05750.pep: gold |
Preliminary Size: | 374 |
Sequenced Size: | 440 |
Gene | Date | Evidence |
---|---|---|
CG15434 | 2005-01-01 | Successful iPCR screen |
CG15434 | 2008-04-29 | Release 5.5 accounting |
CG15434 | 2008-08-15 | Release 5.9 accounting |
CG15434 | 2008-12-18 | 5.12 accounting |
440 bp (440 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023623
> IP05750.complete CGTAGTACCGACATTTAAATAGACTTACTTCCTGAACATTTCAAAATCGC AAAAGTGGTGCCAAAATGGGTATTACTCTGTTCCGATTGGCCAGTTTTAC TCCAAAACTGAAGGAGCTGCGAATCATTCTGGATCCCAAAGGAGACACTT CCAAGGGAGTCAGGGAATACGTGGAAAGGTTCTATCCAAACCTGAAGAAG AGCAATCCCGACCTGCCGATCCTCGTGCGCGAGTGCTCTGGCGTCCAGCC CCGCCTCTACGCCCGCTATGGCAACGGCAAGGAAGTGTCCCTCTCCCTGG CCAACCACGCTGCTCCTGACATACACAAAAACCTGGAAGCGGTTGGCAAA TAGAACTTACGCTGGAAAACTATGTAGATTAGGCGCAAAATAAAGGCAAA GCCAGATGCTTTATGCACACATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 4454188..4454340 | 270..422 | 750 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 4453798..4453961 | 1..164 | 745 | 97 | Plus |
chr2L | 23010047 | chr2L | 4454018..4454128 | 161..271 | 465 | 94.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4453798..4453960 | 1..163 | 96 | -> | Plus |
chr2L | 4454021..4454127 | 164..270 | 94 | -> | Plus |
chr2L | 4454189..4454340 | 271..422 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..288 | 66..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..288 | 66..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..288 | 66..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..288 | 66..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..288 | 66..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..374 | 2..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..422 | 1..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 39..460 | 1..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 1..374 | 2..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15434-RA | 39..460 | 1..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4454664..4454826 | 1..163 | 100 | -> | Plus |
2L | 4454888..4454994 | 164..270 | 100 | -> | Plus |
2L | 4455056..4455207 | 271..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4454664..4454826 | 1..163 | 100 | -> | Plus |
2L | 4454888..4454994 | 164..270 | 100 | -> | Plus |
2L | 4455056..4455207 | 271..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4454664..4454826 | 1..163 | 100 | -> | Plus |
2L | 4454888..4454994 | 164..270 | 100 | -> | Plus |
2L | 4455056..4455207 | 271..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4454664..4454826 | 1..163 | 100 | -> | Plus |
arm_2L | 4454888..4454994 | 164..270 | 100 | -> | Plus |
arm_2L | 4455056..4455207 | 271..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4454664..4454826 | 1..163 | 100 | -> | Plus |
2L | 4454888..4454994 | 164..270 | 100 | -> | Plus |
2L | 4455056..4455207 | 271..422 | 100 | Plus |
Translation from 65 to 352
> IP05750.hyp MGITLFRLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDL PILVRECSGVQPRLYARYGNGKEVSLSLANHAAPDIHKNLEAVGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15434-PA | 95 | CG15434-PA | 1..95 | 1..95 | 491 | 100 | Plus |
Translation from 65 to 352
> IP05750.pep MGITLFRLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDL PILVRECSGVQPRLYARYGNGKEVSLSLANHAAPDIHKNLEAVGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21244-PA | 95 | GF21244-PA | 1..95 | 1..95 | 384 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25005-PA | 95 | GG25005-PA | 1..95 | 1..95 | 458 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10130-PA | 94 | GH10130-PA | 1..90 | 1..94 | 295 | 60.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-B8-PA | 95 | CG15434-PA | 1..95 | 1..95 | 491 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22161-PA | 95 | GI22161-PA | 1..95 | 1..95 | 310 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15196-PA | 95 | GL15196-PA | 1..95 | 1..95 | 385 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13724-PA | 95 | GA13724-PA | 1..95 | 1..95 | 385 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18475-PA | 89 | GM18475-PA | 1..74 | 1..74 | 343 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23289-PA | 91 | GD23289-PA | 1..91 | 1..95 | 436 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20029-PA | 95 | GJ20029-PA | 1..95 | 1..95 | 356 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23749-PA | 95 | GK23749-PA | 1..95 | 1..95 | 391 | 74.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18292-PA | 95 | GE18292-PA | 1..95 | 1..95 | 463 | 94.7 | Plus |