Clone IP05750 Report

Search the DGRC for IP05750

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:50
Vector:pOT2
Associated Gene/TranscriptCG15434-RA
Protein status:IP05750.pep: gold
Preliminary Size:374
Sequenced Size:440

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15434 2005-01-01 Successful iPCR screen
CG15434 2008-04-29 Release 5.5 accounting
CG15434 2008-08-15 Release 5.9 accounting
CG15434 2008-12-18 5.12 accounting

Clone Sequence Records

IP05750.complete Sequence

440 bp (440 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023623

> IP05750.complete
CGTAGTACCGACATTTAAATAGACTTACTTCCTGAACATTTCAAAATCGC
AAAAGTGGTGCCAAAATGGGTATTACTCTGTTCCGATTGGCCAGTTTTAC
TCCAAAACTGAAGGAGCTGCGAATCATTCTGGATCCCAAAGGAGACACTT
CCAAGGGAGTCAGGGAATACGTGGAAAGGTTCTATCCAAACCTGAAGAAG
AGCAATCCCGACCTGCCGATCCTCGTGCGCGAGTGCTCTGGCGTCCAGCC
CCGCCTCTACGCCCGCTATGGCAACGGCAAGGAAGTGTCCCTCTCCCTGG
CCAACCACGCTGCTCCTGACATACACAAAAACCTGGAAGCGGTTGGCAAA
TAGAACTTACGCTGGAAAACTATGTAGATTAGGCGCAAAATAAAGGCAAA
GCCAGATGCTTTATGCACACATAAAAAAAAAAAAAAAAAA

IP05750.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15434-RA 422 CG15434-RA 48..422 1..375 1875 100 Plus
Gs1l-RB 1124 Gs1l-RB 1087..1124 423..386 190 100 Minus
Gs1l-RA 1124 Gs1l-RA 1087..1124 423..386 190 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4454188..4454340 270..422 750 99.3 Plus
chr2L 23010047 chr2L 4453798..4453961 1..164 745 97 Plus
chr2L 23010047 chr2L 4454018..4454128 161..271 465 94.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4454664..4454827 1..164 820 100 Plus
2L 23513712 2L 4455055..4455208 270..423 770 100 Plus
2L 23513712 2L 4454885..4454995 161..271 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4454664..4454827 1..164 820 100 Plus
2L 23513712 2L 4455055..4455208 270..423 770 100 Plus
2L 23513712 2L 4454885..4454995 161..271 555 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:11:51 has no hits.

IP05750.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:12:58 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4453798..4453960 1..163 96 -> Plus
chr2L 4454021..4454127 164..270 94 -> Plus
chr2L 4454189..4454340 271..422 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:16 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..288 66..353 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:35 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..288 66..353 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:46:41 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..288 66..353 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:13:38 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..288 66..353 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:36:41 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..288 66..353 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:51 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..374 2..375 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:35 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..422 1..422 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:46:41 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 39..460 1..422 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:13:38 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 1..374 2..375 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:36:41 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
CG15434-RA 39..460 1..422 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:12:58 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4454664..4454826 1..163 100 -> Plus
2L 4454888..4454994 164..270 100 -> Plus
2L 4455056..4455207 271..422 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:12:58 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4454664..4454826 1..163 100 -> Plus
2L 4454888..4454994 164..270 100 -> Plus
2L 4455056..4455207 271..422 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:12:58 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4454664..4454826 1..163 100 -> Plus
2L 4454888..4454994 164..270 100 -> Plus
2L 4455056..4455207 271..422 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:46:41 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4454664..4454826 1..163 100 -> Plus
arm_2L 4454888..4454994 164..270 100 -> Plus
arm_2L 4455056..4455207 271..422 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:13 Download gff for IP05750.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4454664..4454826 1..163 100 -> Plus
2L 4454888..4454994 164..270 100 -> Plus
2L 4455056..4455207 271..422 100   Plus

IP05750.hyp Sequence

Translation from 65 to 352

> IP05750.hyp
MGITLFRLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDL
PILVRECSGVQPRLYARYGNGKEVSLSLANHAAPDIHKNLEAVGK*

IP05750.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15434-PA 95 CG15434-PA 1..95 1..95 491 100 Plus

IP05750.pep Sequence

Translation from 65 to 352

> IP05750.pep
MGITLFRLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDL
PILVRECSGVQPRLYARYGNGKEVSLSLANHAAPDIHKNLEAVGK*

IP05750.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21244-PA 95 GF21244-PA 1..95 1..95 384 73.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25005-PA 95 GG25005-PA 1..95 1..95 458 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10130-PA 94 GH10130-PA 1..90 1..94 295 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B8-PA 95 CG15434-PA 1..95 1..95 491 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22161-PA 95 GI22161-PA 1..95 1..95 310 60 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15196-PA 95 GL15196-PA 1..95 1..95 385 71.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13724-PA 95 GA13724-PA 1..95 1..95 385 71.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18475-PA 89 GM18475-PA 1..74 1..74 343 89.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23289-PA 91 GD23289-PA 1..91 1..95 436 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20029-PA 95 GJ20029-PA 1..95 1..95 356 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23749-PA 95 GK23749-PA 1..95 1..95 391 74.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18292-PA 95 GE18292-PA 1..95 1..95 463 94.7 Plus