IP05753.complete Sequence
332 bp (332 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023624
> IP05753.complete
ACACATCAGAAATTTTGTTGAAAAAAAAAAAGGAGTCCACATAGTTTTCG
TTCCCGTTGAGTCGAGCAATCAGTTTTGTGGCGCTATGGTGGAGAAAACC
AAAACACTTCAGCTGCTGCTAATGGCTCGCGCCGTATTGACGATCATCTA
TAATGACCACTTCTGCTGGACCTTCATAAAGAGCTATGGACTCTTCTCGC
TGGCGATTCCGCTGGCCAAGTACTTCGATGGCTTCCAAGTGTTGCCCACC
GGTGACGTGTAATTTTCAGCCAATTGTACATAAATTAAATGTCTTTGGAT
CAAGGCAAACGTAAAAAAAAAAAAAAAAAAAA
IP05753.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15461-RA | 659 | CG15461-RA | 218..534 | 1..317 | 1585 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:32:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 20351855..20352096 | 71..312 | 1210 | 100 | Plus |
chrX | 22417052 | chrX | 20351711..20351781 | 1..73 | 300 | 97.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:32:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 20486347..20486593 | 71..317 | 1235 | 100 | Plus |
X | 23542271 | X | 20486200..20486272 | 1..73 | 365 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 20471439..20471685 | 71..317 | 1235 | 100 | Plus |
X | 23527363 | X | 20471292..20471364 | 1..73 | 365 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:32:40 has no hits.
IP05753.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:33:27 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 20351711..20351781 | 1..73 | 97 | -> | Plus |
chrX | 20351858..20352096 | 74..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:17 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 1..177 | 86..262 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:51 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 1..177 | 86..262 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:58 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 1..177 | 86..262 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:44 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 1..177 | 86..262 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:56 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 1..177 | 86..262 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:00 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 21..332 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:50 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 21..332 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:58 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 21..332 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:44 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 21..332 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:56 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15461-RA | 21..332 | 1..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20486200..20486272 | 1..73 | 100 | -> | Plus |
X | 20486350..20486588 | 74..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20486200..20486272 | 1..73 | 100 | -> | Plus |
X | 20486350..20486588 | 74..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20486200..20486272 | 1..73 | 100 | -> | Plus |
X | 20486350..20486588 | 74..312 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:58 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 20357227..20357299 | 1..73 | 100 | -> | Plus |
arm_X | 20357377..20357615 | 74..312 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:40 Download gff for
IP05753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20471292..20471364 | 1..73 | 100 | -> | Plus |
X | 20471442..20471680 | 74..312 | 100 | | Plus |
IP05753.hyp Sequence
Translation from 0 to 261
> IP05753.hyp
HIRNFVEKKKGVHIVFVPVESSNQFCGAMVEKTKTLQLLLMARAVLTIIY
NDHFCWTFIKSYGLFSLAIPLAKYFDGFQVLPTGDV*
IP05753.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15461-PA | 58 | CG15461-PA | 1..58 | 29..86 | 302 | 100 | Plus |
IP05753.pep Sequence
Translation from 85 to 261
> IP05753.pep
MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGF
QVLPTGDV*
IP05753.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15964-PA | 61 | GF15964-PA | 1..54 | 1..54 | 188 | 61.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19689-PA | 59 | GG19689-PA | 1..58 | 1..58 | 268 | 87.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15461-PA | 58 | CG15461-PA | 1..58 | 1..58 | 302 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23039-PA | 58 | GM23039-PA | 1..58 | 1..58 | 276 | 93.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17493-PA | 58 | GD17493-PA | 1..58 | 1..58 | 271 | 89.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19381-PA | 62 | GK19381-PA | 1..51 | 2..55 | 142 | 46.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17887-PA | 58 | GE17887-PA | 1..58 | 1..58 | 282 | 93.1 | Plus |