Clone IP05753 Report

Search the DGRC for IP05753

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:53
Vector:pOT2
Associated Gene/TranscriptCG15461-RA
Protein status:IP05753.pep: gold
Preliminary Size:351
Sequenced Size:332

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15461 2005-01-01 Successful iPCR screen
CG15461 2008-04-29 Release 5.5 accounting
CG15461 2008-08-15 Release 5.9 accounting
CG15461 2008-12-18 5.12 accounting

Clone Sequence Records

IP05753.complete Sequence

332 bp (332 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023624

> IP05753.complete
ACACATCAGAAATTTTGTTGAAAAAAAAAAAGGAGTCCACATAGTTTTCG
TTCCCGTTGAGTCGAGCAATCAGTTTTGTGGCGCTATGGTGGAGAAAACC
AAAACACTTCAGCTGCTGCTAATGGCTCGCGCCGTATTGACGATCATCTA
TAATGACCACTTCTGCTGGACCTTCATAAAGAGCTATGGACTCTTCTCGC
TGGCGATTCCGCTGGCCAAGTACTTCGATGGCTTCCAAGTGTTGCCCACC
GGTGACGTGTAATTTTCAGCCAATTGTACATAAATTAAATGTCTTTGGAT
CAAGGCAAACGTAAAAAAAAAAAAAAAAAAAA

IP05753.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-RA 659 CG15461-RA 218..534 1..317 1585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20351855..20352096 71..312 1210 100 Plus
chrX 22417052 chrX 20351711..20351781 1..73 300 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20486347..20486593 71..317 1235 100 Plus
X 23542271 X 20486200..20486272 1..73 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20471439..20471685 71..317 1235 100 Plus
X 23527363 X 20471292..20471364 1..73 365 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:32:40 has no hits.

IP05753.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:33:27 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20351711..20351781 1..73 97 -> Plus
chrX 20351858..20352096 74..312 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:17 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 1..177 86..262 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:51 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 1..177 86..262 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:58 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 1..177 86..262 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:44 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 1..177 86..262 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:56 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 1..177 86..262 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:00 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 21..332 1..312 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:50 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 21..332 1..312 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:58 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 21..332 1..312 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:44 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 21..332 1..312 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:56 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 21..332 1..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
X 20486200..20486272 1..73 100 -> Plus
X 20486350..20486588 74..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
X 20486200..20486272 1..73 100 -> Plus
X 20486350..20486588 74..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:27 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
X 20486200..20486272 1..73 100 -> Plus
X 20486350..20486588 74..312 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:58 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20357227..20357299 1..73 100 -> Plus
arm_X 20357377..20357615 74..312 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:40 Download gff for IP05753.complete
Subject Subject Range Query Range Percent Splice Strand
X 20471292..20471364 1..73 100 -> Plus
X 20471442..20471680 74..312 100   Plus

IP05753.hyp Sequence

Translation from 0 to 261

> IP05753.hyp
HIRNFVEKKKGVHIVFVPVESSNQFCGAMVEKTKTLQLLLMARAVLTIIY
NDHFCWTFIKSYGLFSLAIPLAKYFDGFQVLPTGDV*

IP05753.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-PA 58 CG15461-PA 1..58 29..86 302 100 Plus

IP05753.pep Sequence

Translation from 85 to 261

> IP05753.pep
MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGF
QVLPTGDV*

IP05753.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15964-PA 61 GF15964-PA 1..54 1..54 188 61.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19689-PA 59 GG19689-PA 1..58 1..58 268 87.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-PA 58 CG15461-PA 1..58 1..58 302 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23039-PA 58 GM23039-PA 1..58 1..58 276 93.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17493-PA 58 GD17493-PA 1..58 1..58 271 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19381-PA 62 GK19381-PA 1..51 2..55 142 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17887-PA 58 GE17887-PA 1..58 1..58 282 93.1 Plus