Clone IP05759 Report

Search the DGRC for IP05759

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:59
Vector:pOT2
Associated Gene/TranscriptHP6-RA
Protein status:IP05759.pep: gold
Preliminary Size:321
Sequenced Size:484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15636 2005-01-01 Successful iPCR screen
Umbrea 2008-04-29 Release 5.5 accounting
Umbrea 2008-08-15 Release 5.9 accounting
Umbrea 2008-12-18 5.12 accounting

Clone Sequence Records

IP05759.complete Sequence

484 bp (484 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023621

> IP05759.complete
CGTGACAATTGGCTACGCGCGTCGAAAAAAGAAAAATAGATTACATTGAA
ATAAATCCCACGATATCTAAAACCAAACGGAAGATGCCCAGCTCCACTTT
GACGTCCTCTACTGCTCTTCCGGTGAAGCAACGAAATGGATTTGATCTTG
GACTCGAACCGTTGCGGATCTTAGGAGCCTGCAACTGGTCCGGTAAGCTG
ACCTTTTTGATGCAGTGGAAGGGTTGCGACGAAGCCGGCCTGGTGCCCGC
CGAAGTGCTCAACGTTCGGTGCCCCCAAATGGTCATCTCGTTCTACGAGG
AGCGTATTGTGTTCACGGATGAGGGCGATGAAGAAGACTTGGAGTCGGAC
AATGGGTATGAGACCACTCCGAGTCCCAGGAAGAAACGATCACGAAATGC
CTAGTCCATAAAACTATTGTGCACCGAAGACATTGCGGTGCAATGTCAAT
AAAGAGTATTGACTCTTCAAAAAAAAAAAAAAAA

IP05759.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-RA 468 HP6-RA 1..468 1..468 2340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4576858..4577325 468..1 2310 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4577719..4578186 468..1 2340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4577719..4578186 468..1 2340 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:28:26 has no hits.

IP05759.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:29:35 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4576858..4577325 1..468 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:18 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:04 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:00 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:27 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:49 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:40 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:04 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 16..483 1..468 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:00 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 16..483 1..468 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:27 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:49 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 33..500 1..468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:35 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4577719..4578186 1..468 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:35 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4577719..4578186 1..468 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:35 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4577719..4578186 1..468 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:00 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4577719..4578186 1..468 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:03 Download gff for IP05759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4577719..4578186 1..468 100   Minus

IP05759.hyp Sequence

Translation from 83 to 403

> IP05759.hyp
MPSSTLTSSTALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDE
AGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSPRK
KRSRNA*

IP05759.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-PA 106 CG15636-PA 1..106 1..106 561 100 Plus
HP1b-PB 240 CG7041-PB 90..152 15..77 192 58.7 Plus
HP1b-PC 240 CG7041-PC 90..152 15..77 192 58.7 Plus
HP1b-PA 240 CG7041-PA 90..152 15..77 192 58.7 Plus
Su(var)205-PB 206 CG8409-PB 127..206 4..83 184 45 Plus

IP05759.pep Sequence

Translation from 83 to 403

> IP05759.pep
MPSSTLTSSTALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDE
AGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSPRK
KRSRNA*

IP05759.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19189-PA 227 GF19189-PA 94..152 19..77 218 62.7 Plus
Dana\GF15276-PA 210 GF15276-PA 135..210 8..82 202 52.6 Plus
Dana\GF13301-PA 132 GF13301-PA 55..119 20..84 147 46.2 Plus
Dana\GF16710-PA 231 GF16710-PA 75..134 14..73 134 36.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24367-PA 106 GG24367-PA 3..106 2..106 329 60.2 Plus
Dere\GG18283-PA 238 GG18283-PA 94..152 19..77 218 62.7 Plus
Dere\GG23468-PA 205 GG23468-PA 141..205 19..82 195 55.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17802-PA 215 GH17802-PA 89..151 15..77 212 58.7 Plus
Dgri\GH10251-PA 203 GH10251-PA 139..195 19..75 188 59.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-PA 106 CG15636-PA 1..106 1..106 561 100 Plus
HP1b-PB 240 CG7041-PB 90..152 15..77 192 58.7 Plus
HP1b-PC 240 CG7041-PC 90..152 15..77 192 58.7 Plus
HP1b-PA 240 CG7041-PA 90..152 15..77 192 58.7 Plus
Su(var)205-PB 206 CG8409-PB 127..206 4..83 184 45 Plus
Su(var)205-PA 206 CG8409-PA 127..206 4..83 184 45 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15142-PA 211 GI15142-PA 90..152 15..77 215 60.3 Plus
Dmoj\GI15430-PA 226 GI15430-PA 162..226 19..82 197 56.9 Plus
Dmoj\GI20276-PA 180 GI20276-PA 88..153 19..84 187 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15653-PA 133 GL15653-PA 27..85 20..77 205 59.3 Plus
Dper\GL12976-PA 266 GL12976-PA 93..151 19..77 192 59.3 Plus
Dper\GL19396-PA 205 GL19396-PA 141..199 19..77 188 54.2 Plus
Dper\GL13026-PA 310 GL13026-PA 212..279 19..86 169 42.6 Plus
Dper\GL27075-PA 90 GL27075-PA 7..59 19..71 139 50.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26074-PA 140 GA26074-PA 27..85 20..77 204 61 Plus
Dpse\GA29223-PA 140 GA29223-PA 27..85 20..77 199 59.3 Plus
Dpse\HP1B-PA 234 GA20053-PA 93..151 19..77 190 57.6 Plus
Dpse\HP1A-PA 205 GA21056-PA 141..199 19..77 188 54.2 Plus
Dpse\HP1F-PA 518 GA25885-PA 420..487 19..86 170 42.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18083-PA 99 GM18083-PA 9..89 3..83 351 81.5 Plus
Dsec\GM13712-PA 240 GM13712-PA 94..152 19..77 206 61 Plus
Dsec\GM13138-PA 206 GM13138-PA 135..206 12..82 201 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\HP6-PA 112 GD22699-PA 9..112 3..106 406 75 Plus
Dsim\GD16926-PA 240 GD16926-PA 94..152 19..77 206 61 Plus
Dsim\GD22433-PA 206 GD22433-PA 127..206 4..82 199 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19002-PA 128 GJ19002-PA 9..71 15..77 217 61.9 Plus
Dvir\Su(var)205-PA 213 GJ17281-PA 149..213 19..82 197 56.9 Plus
Dvir\GJ22004-PA 183 GJ22004-PA 87..157 15..85 181 46.5 Plus
Dvir\GJ22891-PA 235 GJ22891-PA 75..139 14..78 134 33.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16242-PA 277 GK16242-PA 92..154 15..77 220 60.3 Plus
Dwil\GK14980-PA 205 GK14980-PA 141..205 19..82 187 55.4 Plus
Dwil\GK15187-PA 369 GK15187-PA 81..166 1..86 166 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14704-PA 108 GE14704-PA 2..107 5..105 357 66 Plus
Dyak\GE15815-PA 240 GE15815-PA 94..152 19..77 218 62.7 Plus
Dyak\Su(var)205-PA 205 GE11133-PA 126..205 4..82 205 48.8 Plus