IP05761.complete Sequence
489 bp (489 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022445
> IP05761.complete
CAAATAGCAGCAGGAAACAAAATTTCAAGGCATTCCGGAAAATTCGACAG
AAGTGTAACTAAAAGTGTTGAACTGCATCTAAATGGCCAGCATATCGTTT
AAGGGTCGACCCACCCAGGTGTTGCACACCTATCAAGTTTGGCGCATTGG
CAGCGATGAAAACGACAAGAGTCTTGACTATTATTCGCCCGATAAGTCGT
TGCATAAGTTGCATGCCAGCTTGACGCGCAGCGAGAATGCATTGATTTTG
GATAACGAAAGTCGCATCGGATGTGTAGCCGTAAATGGGACAAGGATCGG
TGGTCCGATGATCATTACCTATCGCGATGCCATCAATGGCATTGTTAAGC
TCCGATTTGGCAATATCGAGGGATATCTTCGCGTATCGGGGAGCATCACC
GGCTAACAAGCGTTAAATCGCTTGTTCTTTTTGTATCGAATCGAACATAT
GCTTGATTAAAGGAATTAAAATCAAAAAAAAAAAAAAAA
IP05761.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:14:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15734-RD | 840 | CG15734-RD | 253..726 | 1..474 | 2370 | 100 | Plus |
CG15734-RC | 840 | CG15734-RC | 253..726 | 1..474 | 2370 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:23:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 11977503..11977782 | 473..194 | 1400 | 100 | Minus |
chrX | 22417052 | chrX | 11977848..11978043 | 196..1 | 980 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 12086485..12086765 | 474..194 | 1405 | 100 | Minus |
X | 23542271 | X | 12086831..12087026 | 196..1 | 980 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 12094583..12094863 | 474..194 | 1405 | 100 | Minus |
X | 23527363 | X | 12094929..12095124 | 196..1 | 980 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 15:23:36 has no hits.
IP05761.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:24:34 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 11977503..11977779 | 197..473 | 100 | <- | Minus |
chrX | 11977848..11978043 | 1..196 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:21 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RB | 1..312 | 83..406 | 96 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:22 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RD | 1..324 | 83..406 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:27:01 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RC | 1..324 | 83..406 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:43:28 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RB | 1..312 | 83..406 | 96 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:55 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RC | 1..324 | 83..406 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:36 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RA | 1..460 | 2..473 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:22 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RD | 1..472 | 2..473 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:27:01 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RC | 1..472 | 2..473 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:28 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RA | 1..460 | 2..473 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:55 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15734-RC | 1..472 | 2..473 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 12086831..12087026 | 1..196 | 100 | | Minus |
X | 12086486..12086762 | 197..473 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 12086831..12087026 | 1..196 | 100 | | Minus |
X | 12086486..12086762 | 197..473 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 12086831..12087026 | 1..196 | 100 | | Minus |
X | 12086486..12086762 | 197..473 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:27:01 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 11980519..11980795 | 197..473 | 100 | <- | Minus |
arm_X | 11980864..11981059 | 1..196 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:02 Download gff for
IP05761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 12094929..12095124 | 1..196 | 100 | | Minus |
X | 12094584..12094860 | 197..473 | 100 | <- | Minus |
IP05761.hyp Sequence
Translation from 82 to 405
> IP05761.hyp
MASISFKGRPTQVLHTYQVWRIGSDENDKSLDYYSPDKSLHKLHASLTRS
ENALILDNESRIGCVAVNGTRIGGPMIITYRDAINGIVKLRFGNIEGYLR
VSGSITG*
IP05761.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15734-PD | 107 | CG15734-PD | 1..107 | 1..107 | 553 | 100 | Plus |
CG15734-PC | 107 | CG15734-PC | 1..107 | 1..107 | 553 | 100 | Plus |
IP05761.pep Sequence
Translation from 82 to 405
> IP05761.pep
MASISFKGRPTQVLHTYQVWRIGSDENDKSLDYYSPDKSLHKLHASLTRS
ENALILDNESRIGCVAVNGTRIGGPMIITYRDAINGIVKLRFGNIEGYLR
VSGSITG*
IP05761.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:34:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19510-PA | 107 | GF19510-PA | 1..107 | 1..107 | 350 | 63.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15734-PD | 107 | CG15734-PD | 1..107 | 1..107 | 553 | 100 | Plus |
CG15734-PC | 107 | CG15734-PC | 1..107 | 1..107 | 553 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:34:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21628-PA | 107 | GI21628-PA | 1..105 | 1..105 | 361 | 65.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:34:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13032-PA | 104 | GM13032-PA | 1..103 | 1..107 | 480 | 86 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:34:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15939-PA | 108 | GD15939-PA | 1..107 | 1..107 | 495 | 86.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:34:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16565-PA | 114 | GJ16565-PA | 1..114 | 1..107 | 356 | 64 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:34:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16720-PA | 107 | GE16720-PA | 1..107 | 1..107 | 427 | 77.6 | Plus |