Clone IP05761 Report

Search the DGRC for IP05761

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:61
Vector:pOT2
Associated Gene/TranscriptCG15734-RC
Protein status:IP05761.pep: gold
Preliminary Size:312
Sequenced Size:489

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15734 2005-01-01 Successful iPCR screen
CG15734 2008-04-29 Release 5.5 accounting
CG15734 2008-08-15 Release 5.9 accounting
CG15734 2008-12-18 5.12 accounting

Clone Sequence Records

IP05761.complete Sequence

489 bp (489 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022445

> IP05761.complete
CAAATAGCAGCAGGAAACAAAATTTCAAGGCATTCCGGAAAATTCGACAG
AAGTGTAACTAAAAGTGTTGAACTGCATCTAAATGGCCAGCATATCGTTT
AAGGGTCGACCCACCCAGGTGTTGCACACCTATCAAGTTTGGCGCATTGG
CAGCGATGAAAACGACAAGAGTCTTGACTATTATTCGCCCGATAAGTCGT
TGCATAAGTTGCATGCCAGCTTGACGCGCAGCGAGAATGCATTGATTTTG
GATAACGAAAGTCGCATCGGATGTGTAGCCGTAAATGGGACAAGGATCGG
TGGTCCGATGATCATTACCTATCGCGATGCCATCAATGGCATTGTTAAGC
TCCGATTTGGCAATATCGAGGGATATCTTCGCGTATCGGGGAGCATCACC
GGCTAACAAGCGTTAAATCGCTTGTTCTTTTTGTATCGAATCGAACATAT
GCTTGATTAAAGGAATTAAAATCAAAAAAAAAAAAAAAA

IP05761.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15734-RD 840 CG15734-RD 253..726 1..474 2370 100 Plus
CG15734-RC 840 CG15734-RC 253..726 1..474 2370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11977503..11977782 473..194 1400 100 Minus
chrX 22417052 chrX 11977848..11978043 196..1 980 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12086485..12086765 474..194 1405 100 Minus
X 23542271 X 12086831..12087026 196..1 980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12094583..12094863 474..194 1405 100 Minus
X 23527363 X 12094929..12095124 196..1 980 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:23:36 has no hits.

IP05761.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:24:34 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11977503..11977779 197..473 100 <- Minus
chrX 11977848..11978043 1..196 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:21 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RB 1..312 83..406 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:22 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RD 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:27:01 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RC 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:43:28 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RB 1..312 83..406 96   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:55 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RC 1..324 83..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:36 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RA 1..460 2..473 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:22 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RD 1..472 2..473 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:27:01 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RC 1..472 2..473 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:28 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RA 1..460 2..473 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:55 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
CG15734-RC 1..472 2..473 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
X 12086831..12087026 1..196 100   Minus
X 12086486..12086762 197..473 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
X 12086831..12087026 1..196 100   Minus
X 12086486..12086762 197..473 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:34 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
X 12086831..12087026 1..196 100   Minus
X 12086486..12086762 197..473 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:27:01 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11980519..11980795 197..473 100 <- Minus
arm_X 11980864..11981059 1..196 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:02 Download gff for IP05761.complete
Subject Subject Range Query Range Percent Splice Strand
X 12094929..12095124 1..196 100   Minus
X 12094584..12094860 197..473 100 <- Minus

IP05761.hyp Sequence

Translation from 82 to 405

> IP05761.hyp
MASISFKGRPTQVLHTYQVWRIGSDENDKSLDYYSPDKSLHKLHASLTRS
ENALILDNESRIGCVAVNGTRIGGPMIITYRDAINGIVKLRFGNIEGYLR
VSGSITG*

IP05761.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15734-PD 107 CG15734-PD 1..107 1..107 553 100 Plus
CG15734-PC 107 CG15734-PC 1..107 1..107 553 100 Plus

IP05761.pep Sequence

Translation from 82 to 405

> IP05761.pep
MASISFKGRPTQVLHTYQVWRIGSDENDKSLDYYSPDKSLHKLHASLTRS
ENALILDNESRIGCVAVNGTRIGGPMIITYRDAINGIVKLRFGNIEGYLR
VSGSITG*

IP05761.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19510-PA 107 GF19510-PA 1..107 1..107 350 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15734-PD 107 CG15734-PD 1..107 1..107 553 100 Plus
CG15734-PC 107 CG15734-PC 1..107 1..107 553 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21628-PA 107 GI21628-PA 1..105 1..105 361 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13032-PA 104 GM13032-PA 1..103 1..107 480 86 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15939-PA 108 GD15939-PA 1..107 1..107 495 86.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16565-PA 114 GJ16565-PA 1..114 1..107 356 64 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16720-PA 107 GE16720-PA 1..107 1..107 427 77.6 Plus