Clone IP05783 Report

Search the DGRC for IP05783

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:83
Vector:pOT2
Associated Gene/TranscriptGstE9-RA
Protein status:IP05783.pep: gold
Preliminary Size:321
Sequenced Size:791

Clone Sequence Records

IP05783.complete Sequence

791 bp assembled on 2010-06-24

GenBank Submission: BT125030.1

> IP05783.complete
CCAAGGCGAGCGGACACCTGAAGCGATGGGAAAATTAGTACTGTACGGCG
TAGAGGCTAGTCCGCCGGTGCGAGCATGCAAACTGACCCTCGACGCCCTG
GGCCTTCAGTATGAGTATAGGCTGGTGAACCTGCTGGCCGGTGAGCACAA
GACGAAGGAGTTCAGCCTGAAGAATCCGCAGCACACGGTACCCGTGCTGG
AGGACGATGGCAAGTTCATCTGGGAGAGTCACGCCATTTGCGCTTATCTG
GTTAGACGCTATGCCAAGAGTGATGACCTGTATCCCAAGGATTACTTCAA
ACGCGCACTCGTTGATCAGCGCCTGCACTTTGAGTCGGGTGTGTTATTCC
AGGGCTGCATCCGGAACATAGCCATTCCGTTGTTCTACAAGAACATAACT
GAGGTGCCGCGTTCCCAGATTGATGCCATCTACGAGGCCTATGACTTTCT
GGAAGCGTTCATCGGTAATCAGGCTTACCTCTGCGGACCGGTCATAACCA
TCGCCGACTACAGTGTAGTTTCCTCGGTCTCCAGCCTAGTGGGATTGGCC
GCTATCGATGCCAAGCGCTATCCCAAGTTAAACGGCTGGCTAGACAGAAT
GGCCGCACAGCCCAATTACCAGTCGCTCAATGGCAATGGGGCACAGATGT
TGATCGACATGTTCAGTTCGAAGATCACAAAGATTGTGTAATTGTTTGCA
CTAGCTTAAAGGTTACAAACGCAACGTGTTCTGATTACGTAACAATAAAG
CTTCTATTTGTATAAACTTTAAAAAAAAAAAAAAAAAAAAA

IP05783.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
GstE9-RA 825 GstE9-RA 56..825 1..770 3850 100 Plus
imd-RA 1496 imd-RA 1445..1496 777..726 245 98 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14296086..14296856 1..770 3745 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18409066..18409842 1..777 3870 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18410265..18411041 1..777 3870 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 21:15:39 has no hits.

IP05783.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:16:22 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14296086..14296856 1..770 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-24 12:50:34 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 1..666 26..691 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:14 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 1..666 26..691 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:41:54 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 1..666 26..691 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:48:10 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 1..666 26..691 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-24 12:50:33 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 56..825 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:14 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 56..825 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:41:54 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 19..788 1..770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:48:10 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
GstE9-RA 19..788 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:16:22 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18409066..18409835 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:16:22 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18409066..18409835 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:16:22 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18409066..18409835 1..770 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:41:54 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14296571..14297340 1..770 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:55 Download gff for IP05783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18410265..18411034 1..770 100   Plus

IP05783.hyp Sequence

Translation from 0 to 690

> IP05783.hyp
QGERTPEAMGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHK
TKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYAKSDDLYPKDYFK
RALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDFL
EAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRM
AAQPNYQSLNGNGAQMLIDMFSSKITKIV*

IP05783.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
GstE9-PA 221 CG17534-PA 1..221 9..229 1147 100 Plus
GstE7-PA 223 CG17531-PA 1..207 9..215 603 55.1 Plus
GstE6-PA 222 CG17530-PA 1..213 9..221 594 53.1 Plus
GstE8-PB 222 CG17533-PB 1..212 9..220 586 51.9 Plus
GstE8-PA 222 CG17533-PA 1..212 9..220 586 51.9 Plus

IP05783.pep Sequence

Translation from 1 to 690

> IP05783.pep
QGERTPEAMGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHK
TKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYAKSDDLYPKDYFK
RALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDFL
EAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRM
AAQPNYQSLNGNGAQMLIDMFSSKITKIV*

IP05783.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12175-PA 221 GF12175-PA 1..221 9..229 1021 88.7 Plus
Dana\GF12171-PA 222 GF12171-PA 1..216 9..224 626 53.2 Plus
Dana\GF12168-PA 219 GF12168-PA 1..217 9..226 609 48.2 Plus
Dana\GF12173-PA 221 GF12173-PA 1..210 9..219 606 50.7 Plus
Dana\GF12169-PA 221 GF12169-PA 1..220 9..229 593 48.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21891-PA 221 GG21891-PA 1..221 9..229 1063 93.7 Plus
Dere\GG21889-PA 222 GG21889-PA 1..206 9..215 624 55.1 Plus
Dere\GG21890-PA 222 GG21890-PA 1..213 9..221 601 51.6 Plus
Dere\GG21887-PA 222 GG21887-PA 1..209 9..217 598 52.2 Plus
Dere\GG21886-PA 222 GG21886-PA 1..221 9..229 596 47.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21671-PA 221 GH21671-PA 1..220 9..228 895 71.8 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..219 9..228 639 52.7 Plus
Dgri\GH21669-PA 221 GH21669-PA 1..209 9..218 607 52.9 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..217 9..226 565 51.8 Plus
Dgri\GH13569-PA 220 GH13569-PA 1..218 9..228 482 43.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
GstE9-PA 221 CG17534-PA 1..221 9..229 1147 100 Plus
GstE7-PA 223 CG17531-PA 1..207 9..215 603 55.1 Plus
GstE6-PA 222 CG17530-PA 1..213 9..221 594 53.1 Plus
GstE8-PB 222 CG17533-PB 1..212 9..220 586 51.9 Plus
GstE8-PA 222 CG17533-PA 1..212 9..220 586 51.9 Plus
GstE4-PA 222 CG17525-PA 1..221 9..229 583 48 Plus
GstE10-PB 240 CG17522-PB 1..220 9..227 578 50.5 Plus
GstE10-PA 240 CG17522-PA 1..220 9..227 578 50.5 Plus
GstE5-PA 222 CG17527-PA 1..215 9..223 575 50.7 Plus
GstE1-PA 224 CG5164-PA 6..221 12..228 559 49.3 Plus
GstE2-PA 221 CG17523-PA 4..212 11..220 548 49.5 Plus
GstE3-PA 220 CG17524-PA 1..220 9..229 517 45.7 Plus
GstE12-PC 223 CG16936-PC 1..219 9..227 467 45.5 Plus
GstE12-PB 223 CG16936-PB 1..219 9..227 467 45.5 Plus
GstE12-PD 223 CG16936-PD 1..219 9..227 467 45.5 Plus
GstE12-PA 223 CG16936-PA 1..219 9..227 467 45.5 Plus
GstE11-PB 225 CG5224-PB 4..214 11..220 438 45.3 Plus
GstE11-PA 225 CG5224-PA 4..214 11..220 438 45.3 Plus
GstE13-PB 226 CG11784-PB 1..210 9..217 343 36 Plus
GstE13-PA 226 CG11784-PA 1..210 9..217 343 36 Plus
GstD11-PA 222 CG17639-PA 1..219 9..227 336 36 Plus
GstD11-PB 243 CG17639-PB 22..240 9..227 336 36 Plus
GstD1-PB 209 CG10045-PB 5..185 15..198 330 38.6 Plus
GstD1-PA 209 CG10045-PA 5..185 15..198 330 38.6 Plus
GstD7-PA 224 CG4371-PA 1..218 9..224 321 34.2 Plus
GstD8-PA 212 CG4421-PA 9..203 20..217 312 35.9 Plus
GstD6-PA 215 CG4423-PA 3..182 14..196 309 37.3 Plus
GstD3-PA 199 CG4381-PA 5..170 32..200 301 35.5 Plus
GstD2-PA 215 CG4181-PA 13..184 24..198 301 39 Plus
GstD10-PB 210 CG18548-PB 3..185 14..198 298 36 Plus
GstD10-PA 210 CG18548-PA 3..185 14..198 298 36 Plus
GstD5-PA 216 CG12242-PA 6..210 20..224 297 35.5 Plus
GstD4-PA 215 CG11512-PA 13..182 24..196 293 36.4 Plus
GstD9-PB 218 CG10091-PB 2..187 12..198 289 35.8 Plus
GstD9-PA 218 CG10091-PA 2..187 12..198 289 35.8 Plus
gfzf-PD 234 CG33546-PD 3..204 14..215 277 33.2 Plus
gfzf-PE 1045 CG33546-PE 814..1015 14..215 277 33.2 Plus
gfzf-PB 1045 CG33546-PB 814..1015 14..215 277 33.2 Plus
GstE14-PA 232 CG4688-PA 5..208 11..217 259 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20124-PA 221 GI20124-PA 1..221 9..229 913 73.8 Plus
Dmoj\GI16623-PA 219 GI16623-PA 1..219 9..228 664 53.6 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..217 9..222 641 53.7 Plus
Dmoj\GI20123-PA 221 GI20123-PA 1..209 9..218 578 52.4 Plus
Dmoj\GI20122-PA 221 GI20122-PA 1..220 9..229 569 52.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17774-PA 221 GL17774-PA 1..221 9..229 924 80.5 Plus
Dper\GL17771-PA 221 GL17771-PA 1..220 9..229 604 50.2 Plus
Dper\GL17773-PA 222 GL17773-PA 1..210 9..218 583 52.4 Plus
Dper\GL17769-PA 219 GL17769-PA 1..219 9..228 568 48.2 Plus
Dper\GL16704-PA 241 GL16704-PA 1..221 9..227 567 50.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14548-PA 221 GA14548-PA 1..221 9..229 917 79.6 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..220 9..229 604 50.2 Plus
Dpse\GA14545-PA 222 GA14545-PA 1..209 9..217 583 52.2 Plus
Dpse\GA14540-PA 219 GA14540-PA 1..219 9..228 572 48.2 Plus
Dpse\GA14539-PA 241 GA14539-PA 1..221 9..227 568 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21883-PA 221 GM21883-PA 1..221 9..229 1162 98.6 Plus
Dsec\GM21881-PA 223 GM21881-PA 1..209 9..217 641 54.5 Plus
Dsec\GM21882-PA 222 GM21882-PA 1..212 9..220 617 53.3 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..221 9..229 600 47.5 Plus
Dsec\GM21880-PA 222 GM21880-PA 1..215 9..223 596 51.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11378-PA 221 GD11378-PA 1..221 9..229 1165 99.1 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..209 9..217 641 54.5 Plus
Dsim\GD11377-PA 222 GD11377-PA 1..213 9..221 609 52.1 Plus
Dsim\GD11375-PA 222 GD11375-PA 1..213 9..221 605 52.1 Plus
Dsim\GD11372-PA 219 GD11372-PA 1..217 9..226 596 47.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19894-PA 221 GJ19894-PA 1..221 9..229 936 74.2 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..219 9..228 638 52.7 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..221 9..229 582 51.6 Plus
Dvir\GJ19893-PA 221 GJ19893-PA 1..220 9..229 569 53.8 Plus
Dvir\GJ22450-PA 238 GJ22450-PA 3..218 12..227 561 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22992-PA 221 GK22992-PA 1..221 9..229 941 80.5 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..221 9..229 628 50.2 Plus
Dwil\GK22991-PA 222 GK22991-PA 1..216 9..224 622 54.2 Plus
Dwil\GK22985-PA 219 GK22985-PA 1..217 9..226 600 50.9 Plus
Dwil\GK22982-PA 218 GK22982-PA 3..216 12..226 578 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11966-PA 221 GE11966-PA 1..221 9..229 1058 93.7 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..215 9..224 649 55.1 Plus
Dyak\GE11962-PA 222 GE11962-PA 1..215 9..223 608 51.6 Plus
Dyak\GE11963-PA 222 GE11963-PA 1..213 9..221 608 52.1 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..221 9..229 608 47.5 Plus