Clone IP05792 Report

Search the DGRC for IP05792

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:92
Vector:pOT2
Associated Gene/TranscriptCG30381-RA
Protein status:IP05792.pep: validated full length
Preliminary Size:357
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30381 2005-01-01 Successful iPCR screen
CG30381 2008-04-29 Release 5.5 accounting
CG30381 2008-08-15 Release 5.9 accounting
CG30381 2008-12-18 5.12 accounting

Clone Sequence Records

IP05792.complete Sequence

747 bp (747 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023622

> IP05792.complete
GCAACGGTGGCCATACCCCTACCCGAGCTCTATCTCAACTGCCCGATGGC
TGATAGTGCGCTCATCGAAAACGAGTTGGTTGCCCGGCCCGATAAGCTGT
ACTGCCTGAATGCGCCGGAAAGCCGTTTCGACGAGAACCATATCAAGGAT
GGCCAACCCACGACCATGGCTAATCTGGAGCGCTGCAACTGGAGGCGGGT
GCACGTGGACTGCCAGCTAAAGATGCCGCTGCGTGCCGAGATTCCGGTAG
GCCATGCTAGCGCCTACGGTCCAGTTCTGTGCGGCACCATCCTGCTAGGT
TGGTCTCTGGCCCTGTGGACCATCATCCACTCGATGGCCAACACGCGACG
CATCAATCAGCGCCTCAACGAGCAGCGACTTCTGCAGCAAAAAGTCAAGT
AACAGGCGACGAAGTCGGTGCGATTCAAAGTCAGCGATGGCTAATTGAAC
AATACATTTTAGCGATGACACAGGATTGTAAATATGTATTAATATGCTGT
TTGCATAGAAAACTCACTTATTGATATAGTTAAAGCGACTTCAGCAGCTT
CGAAACGTGCCACACATAGTAAAGTCATATTTTGGGCTTATCACACAACT
AAGTCATATTAAGCTTCCCTAAGCATAAGCGTAAACATAAACCATTATCT
TTAGTTATAGCTAGGCATATCCAAATAACGCTGTCACAGCGGCAAGCTTA
AATAAGAATAACTTATAATTACTACAAAAAAAAAAAAAAAAAAAAAA

IP05792.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG30381-RB 1159 CG30381-RB 433..1159 1..727 3635 100 Plus
CG30381-RA 727 CG30381-RA 1..727 1..727 3635 100 Plus
CG30381.a 1103 CG30381.a 377..1103 1..727 3635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3817051..3817775 725..1 3595 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7929656..7930382 727..1 3635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7930855..7931581 727..1 3635 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:32:26 has no hits.

IP05792.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:33:14 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3817051..3817775 1..725 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:28 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..714 1..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:05 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..714 1..402 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:31 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..714 1..402 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:28 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..714 1..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:19 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..714 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:43 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..1037 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:05 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 453..1177 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:31 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 453..1177 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:28 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 313..1037 1..725 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:19 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
CG30381-RB 453..1177 1..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:14 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7929658..7930382 1..725 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:14 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7929658..7930382 1..725 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:14 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7929658..7930382 1..725 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:31 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3817163..3817887 1..725 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:05 Download gff for IP05792.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7930857..7931581 1..725 100   Minus

IP05792.hyp Sequence

Translation from 0 to 401

> IP05792.hyp
ATVAIPLPELYLNCPMADSALIENELVARPDKLYCLNAPESRFDENHIKD
GQPTTMANLERCNWRRVHVDCQLKMPLRAEIPVGHASAYGPVLCGTILLG
WSLALWTIIHSMANTRRINQRLNEQRLLQQKVK*

IP05792.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30381-PB 237 CG30381-PB 105..237 1..133 709 100 Plus
CG30381-PC 243 CG30381-PC 111..243 1..133 709 100 Plus

IP05792.pep Sequence

Translation from 45 to 401

> IP05792.pep
MADSALIENELVARPDKLYCLNAPESRFDENHIKDGQPTTMANLERCNWR
RVHVDCQLKMPLRAEIPVGHASAYGPVLCGTILLGWSLALWTIIHSMANT
RRINQRLNEQRLLQQKVK*

IP05792.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19764-PA 115 GF19764-PA 3..114 6..117 477 79.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10697-PA 237 GG10697-PA 120..237 1..118 621 96.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
PIG-X-PB 237 CG30381-PB 120..237 1..118 628 100 Plus
PIG-X-PC 243 CG30381-PC 126..243 1..118 628 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19731-PA 231 GI19731-PA 126..220 3..107 206 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10385-PA 237 GL10385-PA 120..237 1..118 449 66.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15804-PA 237 GA15804-PA 120..237 1..118 451 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20745-PA 237 GM20745-PA 120..237 1..118 617 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10211-PA 224 GD10211-PA 107..224 1..118 625 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18420-PA 233 GJ18420-PA 120..227 1..115 246 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21349-PA 234 GK21349-PA 120..234 1..118 351 57.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23519-PA 237 GE23519-PA 120..237 1..118 599 93.2 Plus