BDGP Sequence Production Resources |
Search the DGRC for IP05796
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 57 |
Well: | 96 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31126-RA |
Protein status: | IP05796.pep: Inserted from web |
Preliminary Size: | 348 |
Sequenced Size: | 546 |
Gene | Date | Evidence |
---|---|---|
CG31126 | 2005-01-01 | Successful iPCR screen |
CG31126 | 2008-04-29 | Release 5.5 accounting |
CG31126 | 2008-08-15 | Release 5.9 accounting |
CG31126 | 2008-12-18 | 5.12 accounting |
546 bp (546 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023619.1
> IP05796.complete CTGGAGTTTCCATACGAAACCTGAATCAACTGACACCCACAATCAGCAGC TTAGGACAGATCCTCCCCAGAGCCACTATGTCGCAGGAGGCGGGACAGTA TCCGCCCATCGAGTCTGCCATGCGAAAAGCACTAAACACGGAGCTGAAGC CGGTATATCTGGAGGTCATTAACGAATCGCCCCAGCACAATGTCCCCAAG CGGTCGGAGTCCCACTTCCGTGTGTTCGTCGTCTCGGAGAAGTTCAACGA TCTGACGCTCATCAAGCGTCATCGATTGGTTAATGACACGGTAAAAAATG CGCTGAAGGAAGCAGGCTTCGAGTTTATGCACGCCCTGTCCATTGAGGCC AAGACACCCAAGCAGTGGGAACCGGAGCAGGAGCCGGAGAAGAGTCCGCC GTGCCTGGGAGGCCACGGCAAGTAAAAACACAGAAGGAACAGAACTCAAA TTCTATGTACAAAGGACCTACTTTACTATTCACAAAACCAGCTTACGCAA ATACAACAGAATCACCAATGGAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20482937..20483202 | 1..266 | 100 | -> | Plus |
chr3R | 20483259..20483513 | 267..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 29..453 | 1..425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 29..453 | 1..425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 29..453 | 1..425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 29..453 | 1..425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 29..453 | 1..425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 59..579 | 1..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 59..579 | 1..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 69..589 | 1..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 59..579 | 1..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31126-RA | 69..589 | 1..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24659689..24659954 | 1..266 | 100 | -> | Plus |
3R | 24660011..24660265 | 267..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24659689..24659954 | 1..266 | 100 | -> | Plus |
3R | 24660011..24660265 | 267..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24659689..24659954 | 1..266 | 100 | -> | Plus |
3R | 24660011..24660265 | 267..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20485411..20485676 | 1..266 | 100 | -> | Plus |
arm_3R | 20485733..20485987 | 267..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24400520..24400785 | 1..266 | 100 | -> | Plus |
3R | 24400842..24401096 | 267..521 | 100 | Plus |
Translation from 2 to 424
> IP05796.pep GVSIRNLNQLTPTISSLGQILPRATMSQEAGQYPPIESAMRKALNTELKP VYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNA LKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGGHGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17220-PA | 115 | GF17220-PA | 1..115 | 26..140 | 589 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11308-PA | 115 | GG11308-PA | 1..115 | 26..140 | 602 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18440-PA | 114 | GH18440-PA | 1..114 | 26..140 | 523 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31126-PA | 150 | CG31126-PA | 11..150 | 1..140 | 727 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24016-PA | 116 | GI24016-PA | 1..116 | 26..140 | 513 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13616-PA | 114 | GL13616-PA | 1..114 | 26..140 | 553 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16028-PB | 149 | GA16028-PB | 11..149 | 1..140 | 616 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26617-PA | 115 | GM26617-PA | 1..115 | 26..140 | 606 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21119-PA | 115 | GD21119-PA | 1..115 | 26..140 | 606 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23647-PA | 114 | GJ23647-PA | 1..114 | 26..140 | 505 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10967-PA | 114 | GK10967-PA | 1..114 | 26..140 | 544 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23505-PA | 115 | GE23505-PA | 1..115 | 26..140 | 602 | 98.3 | Plus |
Translation from 2 to 424
> IP05796.hyp GVSIRNLNQLTPTISSLGQILPRATMSQEAGQYPPIESAMRKALNTELKP VYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNA LKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGGHGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31126-PA | 150 | CG31126-PA | 11..150 | 1..140 | 727 | 100 | Plus |