Clone IP05796 Report

Search the DGRC for IP05796

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:57
Well:96
Vector:pOT2
Associated Gene/TranscriptCG31126-RA
Protein status:IP05796.pep: Inserted from web
Preliminary Size:348
Sequenced Size:546

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31126 2005-01-01 Successful iPCR screen
CG31126 2008-04-29 Release 5.5 accounting
CG31126 2008-08-15 Release 5.9 accounting
CG31126 2008-12-18 5.12 accounting

Clone Sequence Records

IP05796.complete Sequence

546 bp (546 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023619.1

> IP05796.complete
CTGGAGTTTCCATACGAAACCTGAATCAACTGACACCCACAATCAGCAGC
TTAGGACAGATCCTCCCCAGAGCCACTATGTCGCAGGAGGCGGGACAGTA
TCCGCCCATCGAGTCTGCCATGCGAAAAGCACTAAACACGGAGCTGAAGC
CGGTATATCTGGAGGTCATTAACGAATCGCCCCAGCACAATGTCCCCAAG
CGGTCGGAGTCCCACTTCCGTGTGTTCGTCGTCTCGGAGAAGTTCAACGA
TCTGACGCTCATCAAGCGTCATCGATTGGTTAATGACACGGTAAAAAATG
CGCTGAAGGAAGCAGGCTTCGAGTTTATGCACGCCCTGTCCATTGAGGCC
AAGACACCCAAGCAGTGGGAACCGGAGCAGGAGCCGGAGAAGAGTCCGCC
GTGCCTGGGAGGCCACGGCAAGTAAAAACACAGAAGGAACAGAACTCAAA
TTCTATGTACAAAGGACCTACTTTACTATTCACAAAACCAGCTTACGCAA
ATACAACAGAATCACCAATGGAAAAAAAAAAAAAAAAAAAAAAAAA

IP05796.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31126-RA 701 CG31126-RA 166..690 1..525 2625 100 Plus
Ppox-RA 1802 Ppox-RA 1583..1802 525..306 1100 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20482937..20483202 1..266 1330 100 Plus
chr3R 27901430 chr3R 20483257..20483513 265..521 1285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24659689..24659954 1..266 1330 100 Plus
3R 32079331 3R 24660009..24660269 265..525 1305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24400520..24400785 1..266 1330 100 Plus
3R 31820162 3R 24400840..24401100 265..525 1305 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:35:27 has no hits.

IP05796.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:36:33 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20482937..20483202 1..266 100 -> Plus
chr3R 20483259..20483513 267..521 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:29 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 29..453 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:06 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 29..453 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:02 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 29..453 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:29 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 29..453 1..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:53 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 29..453 1..425 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:45 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 59..579 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:06 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 59..579 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:02 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 69..589 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:29 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 59..579 1..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:53 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
CG31126-RA 69..589 1..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:33 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24659689..24659954 1..266 100 -> Plus
3R 24660011..24660265 267..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:33 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24659689..24659954 1..266 100 -> Plus
3R 24660011..24660265 267..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:33 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24659689..24659954 1..266 100 -> Plus
3R 24660011..24660265 267..521 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:02 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20485411..20485676 1..266 100 -> Plus
arm_3R 20485733..20485987 267..521 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:06 Download gff for IP05796.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24400520..24400785 1..266 100 -> Plus
3R 24400842..24401096 267..521 100   Plus

IP05796.pep Sequence

Translation from 2 to 424

> IP05796.pep
GVSIRNLNQLTPTISSLGQILPRATMSQEAGQYPPIESAMRKALNTELKP
VYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNA
LKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGGHGK*

IP05796.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17220-PA 115 GF17220-PA 1..115 26..140 589 93.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11308-PA 115 GG11308-PA 1..115 26..140 602 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18440-PA 114 GH18440-PA 1..114 26..140 523 84.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31126-PA 150 CG31126-PA 11..150 1..140 727 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24016-PA 116 GI24016-PA 1..116 26..140 513 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13616-PA 114 GL13616-PA 1..114 26..140 553 92.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16028-PB 149 GA16028-PB 11..149 1..140 616 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26617-PA 115 GM26617-PA 1..115 26..140 606 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21119-PA 115 GD21119-PA 1..115 26..140 606 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23647-PA 114 GJ23647-PA 1..114 26..140 505 81.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10967-PA 114 GK10967-PA 1..114 26..140 544 89.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23505-PA 115 GE23505-PA 1..115 26..140 602 98.3 Plus

IP05796.hyp Sequence

Translation from 2 to 424

> IP05796.hyp
GVSIRNLNQLTPTISSLGQILPRATMSQEAGQYPPIESAMRKALNTELKP
VYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNA
LKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGGHGK*

IP05796.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG31126-PA 150 CG31126-PA 11..150 1..140 727 100 Plus