Clone IP05837 Report

Search the DGRC for IP05837

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:58
Well:37
Vector:pOT2
Associated Gene/TranscriptCG15198-RA
Protein status:IP05837.pep: gold
Preliminary Size:369
Sequenced Size:638

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15198 2005-01-01 Successful iPCR screen
CG15198 2008-04-29 Release 5.5 accounting
CG15198 2008-08-15 Release 5.9 accounting
CG15198 2008-12-18 5.12 accounting

Clone Sequence Records

IP05837.complete Sequence

638 bp (638 high quality bases) assembled on 2005-12-20

GenBank Submission: BT024384

> IP05837.complete
AAACCTTACACCGAACAGTTCGGAAAACTAGCCAAAAAAAAAAAAAAATT
CAAAATTTTTCCGTGTGAATAACTCCGTGTTTTTCCACATTTTCTACCTT
TGCCGTTTAAACGTTGCTGCGCTCACCATCACCATGAAAACCCTCGAGTC
CGACGACAAACCCTTCAATCCCTTCTACATTGGCCCACATCCCAGCAAGG
CGTGTGCCATTCCCGAGATTCCCGGCCAGCAATGCTCACCCAACTGTCAG
CCAACTACTACGACCACCAATGGTTCTCCAACGGATGCAACGGATCCCAA
CAGTTTGCCCAGCGGAGCTGCGGGCGGCATGGTAATCGTGGCCAACATAT
ATAGCACCGTCGAGGTCCTGGCCGCCGCCGCTCGTATGGGCGGAGCAGCG
GGCACTGGAGGGGATCAGGGTGCGTCGTCTTCCAACAACACCACATGCAA
GCCGTATCCCTGCATGGAGGGCGCTCGCATCGATGGTCCTGGCTGTGGTT
AGAACCAGAGGAAGTTCACATTGGATCAGAAAGCTTTATCTACCAACTGG
CTATTTGAATAGGCTAACTCGCAACACCAAGCTAGCCCCAAATACAAAAA
TAAAAGGCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP05837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15198-RA 608 CG15198-RA 1..608 1..610 2995 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11139524..11140131 1..610 2985 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11248278..11248892 1..617 3005 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11256376..11256990 1..617 3015 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 12:01:39 has no hits.

IP05837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:02:25 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11139524..11140131 1..610 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:30 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:16 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:36:14 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:55 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:49:28 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:54 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:16 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 43..650 1..610 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:36:14 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 43..650 1..610 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:55 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 1..369 134..502 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:49:28 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
CG15198-RA 43..650 1..610 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:25 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
X 11248278..11248885 1..610 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:25 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
X 11248278..11248885 1..610 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:25 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
X 11248278..11248885 1..610 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:36:14 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11142311..11142918 1..610 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:48 Download gff for IP05837.complete
Subject Subject Range Query Range Percent Splice Strand
X 11256376..11256983 1..610 99   Plus

IP05837.hyp Sequence

Translation from 2 to 501

> IP05837.hyp
TLHRTVRKTSQKKKNSKFFRVNNSVFFHIFYLCRLNVAALTITMKTLESD
DKPFNPFYIGPHPSKACAIPEIPGQQCSPNCQPTTTTTNGSPTDATDPNS
LPSGAAGGMVIVANIYSTVEVLAAAARMGGAAGTGGDQGASSSNNTTCKP
YPCMEGARIDGPGCG*

IP05837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15198-PA 122 CG15198-PA 1..122 44..165 665 100 Plus

IP05837.pep Sequence

Translation from 133 to 501

> IP05837.pep
MKTLESDDKPFNPFYIGPHPSKACAIPEIPGQQCSPNCQPTTTTTNGSPT
DATDPNSLPSGAAGGMVIVANIYSTVEVLAAAARMGGAAGTGGDQGASSS
NNTTCKPYPCMEGARIDGPGCG*

IP05837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22591-PA 162 GF22591-PA 1..161 1..121 278 46 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18401-PA 139 GG18401-PA 1..139 1..122 385 64.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12510-PA 77 GH12510-PA 1..49 1..49 137 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15198-PA 122 CG15198-PA 1..122 1..122 665 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13561-PA 136 GA13561-PA 2..135 6..121 236 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11466-PA 122 GM11466-PA 1..122 1..122 484 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24789-PA 122 GD24789-PA 1..122 1..122 483 91 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19526-PA 93 GJ19526-PA 3..34 7..38 144 75 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16109-PA 268 GK16109-PA 8..41 8..42 144 77.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15917-PA 144 GE15917-PA 1..144 1..122 400 66.7 Plus