Clone IP05921 Report

Search the DGRC for IP05921

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:21
Vector:pOT2
Associated Gene/TranscriptCG14684-RA
Protein status:IP05921.pep: gold
Preliminary Size:381
Sequenced Size:506

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14684 2005-01-01 Successful iPCR screen
CG14684 2008-04-29 Release 5.5 accounting
CG14684 2008-08-15 Release 5.9 accounting
CG14684 2008-12-18 5.12 accounting

Clone Sequence Records

IP05921.complete Sequence

506 bp (506 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023620

> IP05921.complete
TGACCGGTGTTTCCCGGACTGTGCTAAGCATGTTCCGCCGCACTAATGCC
GATCCGGTCATACGGCAATTTATTCTGCGCACTGCAGTCCTCAATTATCT
TGGCAAGAGTCTGCGAGAGCAGTATAATGAATATTGCCTTTTGAGAACCC
AGCACGAAAATATTAGGCTGAAGACTGCGAGTGATCAAGAGCTTGAGGAC
CTGCCGACTCTTTCCGAGCTATTTGAGATGCAACAGTTGAAGACGGCTGC
CACCCATCGTCTGCTGATGCGGGAGTACCAAGAATTGCTTGCCTACATGA
TGGACAAGAGTGATTTGTGGGACAGTCAGGAGTACTTCAAGGCCAAGTCT
GCGCTTGGGGCGGCCATCCACAATCTACGGGTTTGTGCACCCACCAAACC
AATGGACTAAAACCAGTCGAGAGGAACATTTGCCAGATAGAATTCCATTC
AATCAGTATATATACATACATAAATAGTGAAACGATCAAAAAAAAAAAAA
AAAAAA

IP05921.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14684-RA 487 CG14684-RA 1..487 1..487 2435 100 Plus
CG31278-RA 951 CG31278-RA 809..951 487..345 715 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6532518..6533004 1..487 2435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10706974..10707460 1..487 2435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10447805..10448291 1..487 2435 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:18:36 has no hits.

IP05921.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:19:21 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6532518..6533004 1..487 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:34 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..381 30..410 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:10 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..381 30..410 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:19:06 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..381 30..410 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:30 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..381 30..410 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:42 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..381 30..410 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:47 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:10 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:19:06 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:30 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:42 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
CG14684-RA 1..487 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:21 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10706974..10707460 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:21 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10706974..10707460 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:21 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10706974..10707460 1..487 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:19:06 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6532696..6533182 1..487 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:21 Download gff for IP05921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10447805..10448291 1..487 100   Plus

IP05921.hyp Sequence

Translation from 2 to 409

> IP05921.hyp
TGVSRTVLSMFRRTNADPVIRQFILRTAVLNYLGKSLREQYNEYCLLRTQ
HENIRLKTASDQELEDLPTLSELFEMQQLKTAATHRLLMREYQELLAYMM
DKSDLWDSQEYFKAKSALGAAIHNLRVCAPTKPMD*

IP05921.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14684-PA 126 CG14684-PA 1..126 10..135 648 100 Plus

IP05921.pep Sequence

Translation from 29 to 409

> IP05921.pep
MFRRTNADPVIRQFILRTAVLNYLGKSLREQYNEYCLLRTQHENIRLKTA
SDQELEDLPTLSELFEMQQLKTAATHRLLMREYQELLAYMMDKSDLWDSQ
EYFKAKSALGAAIHNLRVCAPTKPMD*

IP05921.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17547-PA 117 GF17547-PA 1..117 1..123 332 56.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17639-PA 126 GG17639-PA 1..126 1..126 565 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14912-PA 137 GH14912-PA 12..131 9..118 263 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14684-PA 126 CG14684-PA 1..126 1..126 648 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23695-PA 140 GI23695-PA 1..134 1..118 284 51.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11981-PA 168 GL11981-PA 45..168 6..126 196 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13174-PA 168 GA13174-PA 45..168 6..126 199 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23892-PA 126 GM23892-PA 1..126 1..126 641 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18703-PA 126 GD18703-PA 1..126 1..126 627 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23254-PA 135 GJ23254-PA 1..129 1..118 287 52.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11805-PA 130 GK11805-PA 5..122 4..118 279 53.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26044-PA 116 GE26044-PA 1..116 1..126 492 76.2 Plus