BDGP Sequence Production Resources |
Search the DGRC for IP05921
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 59 |
Well: | 21 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14684-RA |
Protein status: | IP05921.pep: gold |
Preliminary Size: | 381 |
Sequenced Size: | 506 |
Gene | Date | Evidence |
---|---|---|
CG14684 | 2005-01-01 | Successful iPCR screen |
CG14684 | 2008-04-29 | Release 5.5 accounting |
CG14684 | 2008-08-15 | Release 5.9 accounting |
CG14684 | 2008-12-18 | 5.12 accounting |
506 bp (506 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023620
> IP05921.complete TGACCGGTGTTTCCCGGACTGTGCTAAGCATGTTCCGCCGCACTAATGCC GATCCGGTCATACGGCAATTTATTCTGCGCACTGCAGTCCTCAATTATCT TGGCAAGAGTCTGCGAGAGCAGTATAATGAATATTGCCTTTTGAGAACCC AGCACGAAAATATTAGGCTGAAGACTGCGAGTGATCAAGAGCTTGAGGAC CTGCCGACTCTTTCCGAGCTATTTGAGATGCAACAGTTGAAGACGGCTGC CACCCATCGTCTGCTGATGCGGGAGTACCAAGAATTGCTTGCCTACATGA TGGACAAGAGTGATTTGTGGGACAGTCAGGAGTACTTCAAGGCCAAGTCT GCGCTTGGGGCGGCCATCCACAATCTACGGGTTTGTGCACCCACCAAACC AATGGACTAAAACCAGTCGAGAGGAACATTTGCCAGATAGAATTCCATTC AATCAGTATATATACATACATAAATAGTGAAACGATCAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 6532518..6533004 | 1..487 | 2435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 10706974..10707460 | 1..487 | 2435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 10447805..10448291 | 1..487 | 2435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 6532518..6533004 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..381 | 30..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..381 | 30..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..381 | 30..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..381 | 30..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..381 | 30..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14684-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10706974..10707460 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10706974..10707460 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10706974..10707460 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 6532696..6533182 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10447805..10448291 | 1..487 | 100 | Plus |
Translation from 2 to 409
> IP05921.hyp TGVSRTVLSMFRRTNADPVIRQFILRTAVLNYLGKSLREQYNEYCLLRTQ HENIRLKTASDQELEDLPTLSELFEMQQLKTAATHRLLMREYQELLAYMM DKSDLWDSQEYFKAKSALGAAIHNLRVCAPTKPMD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14684-PA | 126 | CG14684-PA | 1..126 | 10..135 | 648 | 100 | Plus |
Translation from 29 to 409
> IP05921.pep MFRRTNADPVIRQFILRTAVLNYLGKSLREQYNEYCLLRTQHENIRLKTA SDQELEDLPTLSELFEMQQLKTAATHRLLMREYQELLAYMMDKSDLWDSQ EYFKAKSALGAAIHNLRVCAPTKPMD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17547-PA | 117 | GF17547-PA | 1..117 | 1..123 | 332 | 56.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17639-PA | 126 | GG17639-PA | 1..126 | 1..126 | 565 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14912-PA | 137 | GH14912-PA | 12..131 | 9..118 | 263 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14684-PA | 126 | CG14684-PA | 1..126 | 1..126 | 648 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23695-PA | 140 | GI23695-PA | 1..134 | 1..118 | 284 | 51.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11981-PA | 168 | GL11981-PA | 45..168 | 6..126 | 196 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13174-PA | 168 | GA13174-PA | 45..168 | 6..126 | 199 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23892-PA | 126 | GM23892-PA | 1..126 | 1..126 | 641 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18703-PA | 126 | GD18703-PA | 1..126 | 1..126 | 627 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23254-PA | 135 | GJ23254-PA | 1..129 | 1..118 | 287 | 52.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11805-PA | 130 | GK11805-PA | 5..122 | 4..118 | 279 | 53.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26044-PA | 116 | GE26044-PA | 1..116 | 1..126 | 492 | 76.2 | Plus |