Clone IP05930 Report

Search the DGRC for IP05930

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:30
Vector:pOT2
Associated Gene/TranscriptCG14915-RA
Protein status:IP05930.pep: gold
Preliminary Size:363
Sequenced Size:497

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14915 2005-01-01 Successful iPCR screen
CG14915 2008-04-29 Release 5.5 accounting
CG14915 2008-08-15 Release 5.9 accounting
CG14915 2008-12-18 5.12 accounting

Clone Sequence Records

IP05930.complete Sequence

497 bp (497 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023617

> IP05930.complete
TCAAGATGTCGAGCTCTAAACTTGCCCTTCTTATTCTGGTCATTGCCTGT
TTGGTCCTTATCGCATGGGCACGACCCAGGTCGAGATCTTCAATACTCAA
TGAGGTCACATCGCTGCCGGCGGAGAGAAGAATGAGCAACGAAATCATGG
ACCAGATATCGCCCATGAGGAGGCCACACAGGAGGGATTATTTCGTGAAG
AGGCGCCCGGTCATCAGCTCTAGGATGATGATGTCCAGAAGTCCCTTCCT
CGAACGTCTTTACAACGATCCAGTGCCGGAGATTGCACCAGGTGGAGCCA
ACTACTTTGGCAATGACGTCCTGCCGCTTTCAACCTACGAGATCCTGGAA
CCAGAGTCATTGTATTAGAAATAATCTCTAAGCACTAAATATGTAAACGA
ATTAAATTTAATTTAATTTTACAACTGACATTTTGTTCATACAAAGAATG
AAAAATATAATTGATAGTTTGATAAATAAAAAAAAAAAAAAAAAAAA

IP05930.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14915-RA 506 CG14915-RA 30..506 1..477 2385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11069810..11070286 1..477 2385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11071056..11071536 1..481 2405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11071056..11071536 1..481 2405 100 Plus
Blast to na_te.dros performed 2019-03-16 01:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1574..1628 364..418 113 67.3 Plus
Rt1b 5171 Rt1b RT1B 5150bp 105..141 384..421 106 78.9 Plus

IP05930.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:49:34 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11069810..11070286 1..477 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:37 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..363 6..368 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:50 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..363 6..368 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:48 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..363 6..368 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:31 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..363 6..368 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:42:51 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..363 6..368 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:49 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:50 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 30..506 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:48 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 30..506 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:31 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 1..477 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:42:51 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
CG14915-RA 30..506 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:34 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11071056..11071532 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:34 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11071056..11071532 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:34 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11071056..11071532 1..477 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:48 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11071056..11071532 1..477 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:16 Download gff for IP05930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11071056..11071532 1..477 100   Plus

IP05930.hyp Sequence

Translation from 2 to 367

> IP05930.hyp
KMSSSKLALLILVIACLVLIAWARPRSRSSILNEVTSLPAERRMSNEIMD
QISPMRRPHRRDYFVKRRPVISSRMMMSRSPFLERLYNDPVPEIAPGGAN
YFGNDVLPLSTYEILEPESLY*

IP05930.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14915-PA 120 CG14915-PA 1..120 2..121 608 100 Plus

IP05930.pep Sequence

Translation from 5 to 367

> IP05930.pep
MSSSKLALLILVIACLVLIAWARPRSRSSILNEVTSLPAERRMSNEIMDQ
ISPMRRPHRRDYFVKRRPVISSRMMMSRSPFLERLYNDPVPEIAPGGANY
FGNDVLPLSTYEILEPESLY*

IP05930.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15637-PA 118 GF15637-PA 1..118 1..120 425 68.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23700-PA 120 GG23700-PA 1..120 1..120 558 90 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10302-PA 126 GH10302-PA 1..126 1..120 150 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14915-PA 120 CG14915-PA 1..120 1..120 608 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16019-PA 108 GI16019-PA 21..108 20..120 133 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19537-PA 122 GL19537-PA 22..122 22..120 330 64.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13350-PA 122 GA13350-PA 22..122 22..120 330 64.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18840-PA 120 GM18840-PA 1..120 1..120 586 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23758-PA 120 GD23758-PA 1..120 1..120 599 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10499-PA 129 GJ10499-PA 22..129 22..120 167 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18925-PA 123 GK18925-PA 3..123 1..120 224 44.4 Plus
Dwil\GK19155-PA 123 GK19155-PA 3..123 1..120 214 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18509-PA 120 GE18509-PA 1..120 1..120 582 92.5 Plus