BDGP Sequence Production Resources |
Search the DGRC for IP05930
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 59 |
Well: | 30 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14915-RA |
Protein status: | IP05930.pep: gold |
Preliminary Size: | 363 |
Sequenced Size: | 497 |
Gene | Date | Evidence |
---|---|---|
CG14915 | 2005-01-01 | Successful iPCR screen |
CG14915 | 2008-04-29 | Release 5.5 accounting |
CG14915 | 2008-08-15 | Release 5.9 accounting |
CG14915 | 2008-12-18 | 5.12 accounting |
497 bp (497 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023617
> IP05930.complete TCAAGATGTCGAGCTCTAAACTTGCCCTTCTTATTCTGGTCATTGCCTGT TTGGTCCTTATCGCATGGGCACGACCCAGGTCGAGATCTTCAATACTCAA TGAGGTCACATCGCTGCCGGCGGAGAGAAGAATGAGCAACGAAATCATGG ACCAGATATCGCCCATGAGGAGGCCACACAGGAGGGATTATTTCGTGAAG AGGCGCCCGGTCATCAGCTCTAGGATGATGATGTCCAGAAGTCCCTTCCT CGAACGTCTTTACAACGATCCAGTGCCGGAGATTGCACCAGGTGGAGCCA ACTACTTTGGCAATGACGTCCTGCCGCTTTCAACCTACGAGATCCTGGAA CCAGAGTCATTGTATTAGAAATAATCTCTAAGCACTAAATATGTAAACGA ATTAAATTTAATTTAATTTTACAACTGACATTTTGTTCATACAAAGAATG AAAAATATAATTGATAGTTTGATAAATAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14915-RA | 506 | CG14915-RA | 30..506 | 1..477 | 2385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 11069810..11070286 | 1..477 | 2385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 11071056..11071536 | 1..481 | 2405 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 11071056..11071536 | 1..481 | 2405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 11069810..11070286 | 1..477 | 95 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..363 | 6..368 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..363 | 6..368 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..363 | 6..368 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..363 | 6..368 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..363 | 6..368 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..477 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 30..506 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 30..506 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 1..477 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14915-RA | 30..506 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11071056..11071532 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11071056..11071532 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11071056..11071532 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 11071056..11071532 | 1..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11071056..11071532 | 1..477 | 100 | Plus |
Translation from 2 to 367
> IP05930.hyp KMSSSKLALLILVIACLVLIAWARPRSRSSILNEVTSLPAERRMSNEIMD QISPMRRPHRRDYFVKRRPVISSRMMMSRSPFLERLYNDPVPEIAPGGAN YFGNDVLPLSTYEILEPESLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14915-PA | 120 | CG14915-PA | 1..120 | 2..121 | 608 | 100 | Plus |
Translation from 5 to 367
> IP05930.pep MSSSKLALLILVIACLVLIAWARPRSRSSILNEVTSLPAERRMSNEIMDQ ISPMRRPHRRDYFVKRRPVISSRMMMSRSPFLERLYNDPVPEIAPGGANY FGNDVLPLSTYEILEPESLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15637-PA | 118 | GF15637-PA | 1..118 | 1..120 | 425 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23700-PA | 120 | GG23700-PA | 1..120 | 1..120 | 558 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10302-PA | 126 | GH10302-PA | 1..126 | 1..120 | 150 | 35.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14915-PA | 120 | CG14915-PA | 1..120 | 1..120 | 608 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16019-PA | 108 | GI16019-PA | 21..108 | 20..120 | 133 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19537-PA | 122 | GL19537-PA | 22..122 | 22..120 | 330 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13350-PA | 122 | GA13350-PA | 22..122 | 22..120 | 330 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18840-PA | 120 | GM18840-PA | 1..120 | 1..120 | 586 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23758-PA | 120 | GD23758-PA | 1..120 | 1..120 | 599 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10499-PA | 129 | GJ10499-PA | 22..129 | 22..120 | 167 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18925-PA | 123 | GK18925-PA | 3..123 | 1..120 | 224 | 44.4 | Plus |
Dwil\GK19155-PA | 123 | GK19155-PA | 3..123 | 1..120 | 214 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18509-PA | 120 | GE18509-PA | 1..120 | 1..120 | 582 | 92.5 | Plus |