Clone IP05938 Report

Search the DGRC for IP05938

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:38
Vector:pOT2
Associated Gene/TranscriptCG15199-RA
Protein status:IP05938.pep: gold
Preliminary Size:351
Sequenced Size:523

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15199 2005-01-01 Successful iPCR screen
CG15199 2008-04-29 Release 5.5 accounting
CG15199 2008-08-15 Release 5.9 accounting
CG15199 2008-12-18 5.12 accounting

Clone Sequence Records

IP05938.complete Sequence

523 bp (523 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024381

> IP05938.complete
AGCAACCATGTCCGGAGCAGCTTGGATGTCCCTAGCTTTTGTGGCCTGTC
TGCTGGCCGCATCGGTGGACGGCAATGGGTTCAGCACCCAGTATCGTGGT
CACACGCAGCACCCTAGCCTGGCGGAGCACTGCCTCTACGAGGAGTTGGA
CCTGGCCGTTCCACTCAATGGCTACGTTCTGCCCTCCGGTCAGCAGGGCT
ACTGCATTCGCTTGGAGTGCACCGATGACTATCTGCTGTTGATACGCCAC
TGCGACAAACAGCCATGGCCGCGACCTGGCTGCCACCTCTCACCCAACGA
CTATGATTTCAAGTTCCCCGAGTGCTGTCCCCAACTCGAGTGCTCCGACG
AATACTAGATACAAGATACTAGATCCAAAAGCATCGATCTGTTCGGAATT
ACTATTTCTATTTAAACTATAATCCATTGATCTTGTGGCAAAGTTAGCCA
AAGTACTAGTAACAAGTATAATCTTTAGTTAAATAAAAACATATATAGTT
TAAGAAAAAAAAAAAAAAAAAAA

IP05938.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15199-RA 669 CG15199-RA 161..667 1..507 2535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11031732..11031986 504..250 1275 100 Minus
chrX 22417052 chrX 11032048..11032296 249..1 1245 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140471..11140728 507..250 1290 100 Minus
X 23542271 X 11140790..11141038 249..1 1245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11148569..11148826 507..250 1290 100 Minus
X 23527363 X 11148888..11149136 249..1 1245 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:37:44 has no hits.

IP05938.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:38:50 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11032048..11032296 1..249 100   Minus
chrX 11031732..11031986 250..504 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:38 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 1..351 8..358 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:45 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 1..351 8..358 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:27 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 1..351 8..358 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:36 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 1..351 8..358 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:57 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 1..351 8..358 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:53:00 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 161..664 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:45 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 161..664 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:27 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 161..664 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:38 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 161..664 1..504 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:57 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15199-RA 161..664 1..504 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:50 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11140474..11140728 250..504 100 <- Minus
X 11140790..11141038 1..249 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:50 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11140474..11140728 250..504 100 <- Minus
X 11140790..11141038 1..249 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:50 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11140474..11140728 250..504 100 <- Minus
X 11140790..11141038 1..249 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:27 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11034507..11034761 250..504 100 <- Minus
arm_X 11034823..11035071 1..249 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:35 Download gff for IP05938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11148572..11148826 250..504 100 <- Minus
X 11148888..11149136 1..249 100   Minus

IP05938.hyp Sequence

Translation from 0 to 357

> IP05938.hyp
ATMSGAAWMSLAFVACLLAASVDGNGFSTQYRGHTQHPSLAEHCLYEELD
LAVPLNGYVLPSGQQGYCIRLECTDDYLLLIRHCDKQPWPRPGCHLSPND
YDFKFPECCPQLECSDEY*

IP05938.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15199-PB 116 CG15199-PB 1..116 3..118 661 100 Plus
CG15199-PA 116 CG15199-PA 1..116 3..118 661 100 Plus
CG15202-PB 115 CG15202-PB 3..109 12..116 171 37.2 Plus
CG15202-PA 115 CG15202-PA 3..109 12..116 171 37.2 Plus

IP05938.pep Sequence

Translation from 7 to 357

> IP05938.pep
MSGAAWMSLAFVACLLAASVDGNGFSTQYRGHTQHPSLAEHCLYEELDLA
VPLNGYVLPSGQQGYCIRLECTDDYLLLIRHCDKQPWPRPGCHLSPNDYD
FKFPECCPQLECSDEY*

IP05938.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20392-PA 116 GF20392-PA 1..112 1..114 349 56.1 Plus
Dana\GF20297-PA 116 GF20297-PA 6..110 7..114 150 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18877-PA 116 GG18877-PA 1..116 1..116 536 85.3 Plus
Dere\GG18394-PA 115 GG18394-PA 3..109 10..114 156 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24574-PA 112 GH24574-PA 9..111 7..112 253 47.2 Plus
Dgri\GH24397-PA 126 GH24397-PA 18..119 7..113 140 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15199-PB 116 CG15199-PB 1..116 1..116 661 100 Plus
CG15199-PA 116 CG15199-PA 1..116 1..116 661 100 Plus
CG15202-PB 115 CG15202-PB 3..109 10..114 171 37.2 Plus
CG15202-PA 115 CG15202-PA 3..109 10..114 171 37.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15279-PA 115 GI15279-PA 10..115 6..115 252 44.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20256-PA 116 GL20256-PA 1..112 1..112 380 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13562-PA 116 GA13562-PA 1..112 1..112 380 60.7 Plus
Dpse\GA13566-PA 121 GA13566-PA 26..114 27..115 148 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11262-PA 116 GM11262-PA 1..116 1..116 605 98.3 Plus
Dsec\GM11460-PA 115 GM11460-PA 3..109 10..114 158 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24786-PA 115 GD24786-PA 3..109 10..114 155 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16932-PA 116 GJ16932-PA 25..114 23..113 272 54.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17224-PA 110 GK17224-PA 19..109 24..115 263 50 Plus
Dwil\GK15974-PA 110 GK15974-PA 18..104 28..114 138 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17317-PA 120 GE17317-PA 1..120 1..116 535 85.8 Plus
Dyak\GE15912-PA 115 GE15912-PA 24..109 29..114 152 37.9 Plus