Clone IP05946 Report

Search the DGRC for IP05946

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:46
Vector:pOT2
Associated Gene/TranscriptCG15369-RA
Protein status:IP05946.pep: gold
Preliminary Size:369
Sequenced Size:422

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15369 2005-01-01 Successful iPCR screen
CG15369 2008-04-29 Release 5.5 accounting
CG15369 2008-08-15 Release 5.9 accounting
CG15369 2008-12-18 5.12 accounting

Clone Sequence Records

IP05946.complete Sequence

422 bp (422 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023618

> IP05946.complete
TCATATATAAAAATGTTTCTCGCCAAGATTCTAATCCTGTGCACCGCCTG
CGTGTTGGTCAGTGCCACGCCGTTTGGACTCGGTGCACCAAAAGTCCTCG
AAGGCGAGGATCTGGCCAGTGCCCAGCAAACGCTTGAGGCATCCTTGACC
AAATTGGCTGCTGGCGAAGGACCCCACTATCGCCTCTCCAAAATTCTTTC
GGCAACGTCCCAGGTGGTCTCTGGCTTTAAGAATGATTACTCTGTGGAGC
TGATCGATAATCAGGGTGCTACCAAGGTGTGCCAAGTGGACATCTGGTCG
CAAAGCTGGCTTCCCAATGGTATCCAGGTGACCTTCAGGTGCCCAAATGA
ACCAGAACTGGTCAGGAAACACGATGCTTAAATAAACATTATTTTTCAAT
TCAAAAAAAAAAAAAAAAAAAA

IP05946.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-RA 731 CG15369-RA 60..463 1..404 2020 100 Plus
CG15369.a 659 CG15369.a 258..659 1..402 2010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9108949..9109169 182..402 1075 99.1 Plus
chrX 22417052 chrX 9108715..9108896 1..182 910 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9217148..9217370 182..404 1115 100 Plus
X 23542271 X 9216914..9217095 1..182 910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9225246..9225468 182..404 1115 100 Plus
X 23527363 X 9225012..9225193 1..182 910 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:29:30 has no hits.

IP05946.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:30:31 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9108715..9108896 1..182 100 -> Plus
chrX 9108950..9109169 183..402 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:39 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 13..381 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:07 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 13..381 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:34 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 13..381 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:45 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 13..381 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:20 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 13..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:25 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 22..423 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:07 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 22..423 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:34 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 43..444 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:46 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 22..423 1..402 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:20 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 43..444 1..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:31 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 9216914..9217095 1..182 100 -> Plus
X 9217149..9217368 183..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:31 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 9216914..9217095 1..182 100 -> Plus
X 9217149..9217368 183..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:31 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 9216914..9217095 1..182 100 -> Plus
X 9217149..9217368 183..402 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:34 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9110947..9111128 1..182 100 -> Plus
arm_X 9111182..9111401 183..402 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:42 Download gff for IP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 9225247..9225466 183..402 100   Plus
X 9225012..9225193 1..182 100 -> Plus

IP05946.hyp Sequence

Translation from 0 to 380

> IP05946.hyp
SYIKMFLAKILILCTACVLVSATPFGLGAPKVLEGEDLASAQQTLEASLT
KLAAGEGPHYRLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQVDIWS
QSWLPNGIQVTFRCPNEPELVRKHDA*

IP05946.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-PB 122 CG15369-PB 1..122 5..126 628 100 Plus
CG15369-PA 122 CG15369-PA 1..122 5..126 628 100 Plus
CG31313-PB 124 CG31313-PB 7..120 10..120 188 37.4 Plus
CG31313-PA 124 CG31313-PA 7..120 10..120 188 37.4 Plus
Cys-PA 126 CG8050-PA 12..118 11..117 179 38 Plus

IP05946.pep Sequence

Translation from 12 to 380

> IP05946.pep
MFLAKILILCTACVLVSATPFGLGAPKVLEGEDLASAQQTLEASLTKLAA
GEGPHYRLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQVDIWSQSWL
PNGIQVTFRCPNEPELVRKHDA*

IP05946.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15461-PA 125 GF15461-PA 1..125 1..122 418 61.6 Plus
Dana\GF17475-PA 119 GF17475-PA 28..117 29..118 195 48.4 Plus
Dana\GF16067-PA 620 GF16067-PA 201..287 33..120 187 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18301-PA 122 GG18301-PA 1..122 1..122 554 81.1 Plus
Dere\GG21229-PA 124 GG21229-PA 26..117 24..113 191 43 Plus
Dere\GG11133-PA 615 GG11133-PA 194..282 33..120 185 40.4 Plus
Dere\GG21208-PA 126 GG21208-PA 28..124 23..118 169 39.8 Plus
Dere\GG21219-PA 105 GG21219-PA 7..97 23..113 155 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17753-PA 124 GH17753-PA 1..123 1..120 370 56.9 Plus
Dgri\GH14131-PA 120 GH14131-PA 1..111 1..112 223 42.9 Plus
Dgri\GH22731-PA 617 GH22731-PA 197..284 33..120 207 43.2 Plus
Dgri\GH14129-PA 122 GH14129-PA 7..118 6..117 167 33.6 Plus
Dgri\GH14130-PA 132 GH14130-PA 7..124 2..113 153 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-PB 122 CG15369-PB 1..122 1..122 628 100 Plus
CG15369-PA 122 CG15369-PA 1..122 1..122 628 100 Plus
CG31313-PB 124 CG31313-PB 7..120 6..116 188 37.4 Plus
CG31313-PA 124 CG31313-PA 7..120 6..116 188 37.4 Plus
Cys-PA 126 CG8050-PA 12..118 7..113 179 38 Plus
CG12163-PB 475 CG12163-PB 55..143 33..120 178 40.4 Plus
CG12163-PA 614 CG12163-PA 194..282 33..120 178 40.4 Plus
CG8066-PB 104 CG8066-PB 7..100 23..116 170 41.1 Plus
CG8066-PA 104 CG8066-PA 7..100 23..116 170 41.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15508-PA 122 GI15508-PA 1..121 1..121 423 64.5 Plus
Dmoj\GI15509-PA 122 GI15509-PA 1..122 1..122 413 60.7 Plus
Dmoj\GI10664-PA 116 GI10664-PA 1..116 3..122 292 52.1 Plus
Dmoj\GI10660-PA 119 GI10660-PA 7..119 6..122 290 53.8 Plus
Dmoj\GI10663-PA 119 GI10663-PA 1..117 1..120 280 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26833-PA 137 GL26833-PA 1..135 1..122 383 56.3 Plus
Dper\GL24172-PA 122 GL24172-PA 6..120 7..118 212 44.8 Plus
Dper\GL22196-PA 627 GL22196-PA 204..292 33..120 183 39.3 Plus
Dper\GL24171-PA 127 GL24171-PA 29..125 23..118 164 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13677-PA 137 GA13677-PA 1..135 1..122 396 57.8 Plus
Dpse\GA26524-PA 122 GA26524-PA 6..120 7..118 215 44.8 Plus
Dpse\GA27408-PB 477 GA27408-PB 54..142 33..120 183 39.3 Plus
Dpse\GA27408-PA 629 GA27408-PA 206..294 33..120 183 39.3 Plus
Dpse\GA20790-PA 127 GA20790-PA 12..125 7..118 165 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11662-PA 122 GM11662-PA 1..122 1..122 543 83.6 Plus
Dsec\GM25833-PA 124 GM25833-PA 7..117 6..113 188 39.3 Plus
Dsec\GM25843-PA 124 GM25843-PA 7..117 6..113 188 39.3 Plus
Dsec\GM25841-PA 123 GM25841-PA 26..121 24..118 175 42.3 Plus
Dsec\GM26670-PA 105 GM26670-PA 1..103 16..118 173 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16941-PA 122 GD16941-PA 1..122 1..122 567 86.1 Plus
Dsim\GD20414-PA 124 GD20414-PA 7..117 6..113 187 38.4 Plus
Dsim\GD19635-PA 359 GD19635-PA 194..282 33..120 186 40.4 Plus
Dsim\GD20412-PA 123 GD20412-PA 25..121 23..118 173 41.8 Plus
Dsim\GD20413-PA 105 GD20413-PA 7..99 23..115 150 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19267-PA 122 GJ19267-PA 1..122 1..122 376 55.7 Plus
Dvir\GJ11017-PA 599 GJ11017-PA 179..266 33..120 226 46.6 Plus
Dvir\GJ23017-PA 126 GJ23017-PA 1..124 1..119 209 41.6 Plus
Dvir\GJ23015-PA 110 GJ23015-PA 8..107 20..118 148 36.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25384-PA 129 GK25384-PA 1..125 1..122 337 48.8 Plus
Dwil\GK11352-PA 120 GK11352-PA 1..119 1..120 307 50.8 Plus
Dwil\GK14287-PA 610 GK14287-PA 192..275 37..120 206 44 Plus
Dwil\GK11350-PA 124 GK11350-PA 25..122 23..119 190 40.8 Plus
Dwil\GK11742-PA 128 GK11742-PA 9..120 1..113 189 38.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25302-PA 615 GE25302-PA 194..282 33..120 189 41.6 Plus
Dyak\GE26442-PA 124 GE26442-PA 7..101 6..100 181 40.6 Plus
Dyak\Cys-PA 123 GE26440-PA 25..121 23..118 158 39.8 Plus
Dyak\GE26441-PA 105 GE26441-PA 7..99 23..115 151 38.3 Plus