Clone IP05962 Report

Search the DGRC for IP05962

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:62
Vector:pOT2
Associated Gene/TranscriptCG15863-RA
Protein status:IP05962.pep: gold
Preliminary Size:399
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15863 2005-01-01 Successful iPCR screen
CG15863 2008-04-29 Release 5.5 accounting
CG15863 2008-08-15 Release 5.9 accounting
CG15863 2008-12-18 5.12 accounting

Clone Sequence Records

IP05962.complete Sequence

550 bp (550 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023615

> IP05962.complete
TTTGAAGAAATATCATTTGCAAAATGTCGCAAACAGATCTGAACAAAAGT
ATTGAGATAATAACCAAGACCGAGGAGTTGGCCGACAAAATTCTGGTCAA
CAAGCAGGAACTGACGGTAATGGATAAACGCCGCCAAGAAACCCGGCAGG
CAATGCGGCTGATGGAGAAGTCGGAGGACAAGAAAGTTTGGATCACTATT
GGCAGTATGCTAGTCAAAATGGAGCGGGAAAAGGCATTGGAACTGCTCAA
AAAAGATCAACAGAAAATAGAACAGCAAATCAATCTGATATACTCAGATC
AGAAAGTTCTGGTGAACAAACATCGCGATTTGGAGTTCAAATCGCCCTTC
TCGGGTACACATCTTAAGCCCTTAGAAAAGAAGGAGTTCGACGCTCTGAA
AGCAAATCTCCCATTACTGTGAAAATCTTCATTTAAGTAAATTTTAGTGA
CCTAAACCTTGAATGCAACATGACCCAAAAAAAAAGATCCGCATTAGCGA
GGTATATAAAGTAAACAATTTTGTATTAATAAAAAAAAAAAAAAAAAAAA

IP05962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG15863-RA 785 CG15863-RA 196..725 1..532 2605 99.6 Plus
CG12130-RA 2621 CG12130-RA 1..86 150..65 430 100 Minus
CG12130-RB 2690 CG12130-RB 1..86 150..65 430 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5846647..5846921 530..254 1320 99.3 Minus
chr2R 21145070 chr2R 5846972..5847226 255..1 1260 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9959117..9959393 532..254 1330 99.3 Minus
2R 25286936 2R 9959444..9959698 255..1 1275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9960316..9960592 532..254 1340 99.2 Minus
2R 25260384 2R 9960643..9960897 255..1 1275 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:25:44 has no hits.

IP05962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:26:37 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5846647..5846919 256..530 99 <- Minus
chr2R 5846972..5847226 1..255 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:41 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:02 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:28:46 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:32 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:30 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:51 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:02 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 196..723 1..530 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:28:46 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 35..562 1..530 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:32 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 1..399 24..422 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:30 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
CG15863-RA 35..562 1..530 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:37 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9959119..9959391 256..530 99 <- Minus
2R 9959444..9959698 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:37 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9959119..9959391 256..530 99 <- Minus
2R 9959444..9959698 1..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:37 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9959119..9959391 256..530 99 <- Minus
2R 9959444..9959698 1..255 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:28:46 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5846624..5846896 256..530 99 <- Minus
arm_2R 5846949..5847203 1..255 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:29 Download gff for IP05962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9960318..9960590 256..530 99 <- Minus
2R 9960643..9960897 1..255 100   Minus

IP05962.hyp Sequence

Translation from 23 to 421

> IP05962.hyp
MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEKS
EDKKVWITIGSMLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKH
RDLEFKSPFSGTHLKPLEKKEFDALKANLPLL*

IP05962.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15863-PA 132 CG15863-PA 1..132 1..132 653 100 Plus

IP05962.pep Sequence

Translation from 23 to 421

> IP05962.pep
MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEKS
EDKKVWITIGSMLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKH
RDLEFKSPFSGTHLKPLEKKEFDALKANLPLL*

IP05962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11299-PA 132 GF11299-PA 1..132 1..132 586 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25244-PA 132 GG25244-PA 1..132 1..132 644 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21640-PA 132 GH21640-PA 1..132 1..132 557 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15863-PA 132 CG15863-PA 1..132 1..132 653 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20093-PA 132 GI20093-PA 1..132 1..132 575 81.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17705-PA 131 GL17705-PA 1..131 1..131 533 77.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13989-PA 131 GA13989-PA 1..131 1..131 529 77.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20565-PA 132 GM20565-PA 1..132 1..132 650 97 Plus
Dsec\GM26744-PA 80 GM26744-PA 1..80 53..132 391 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10036-PA 132 GD10036-PA 1..132 1..132 651 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19860-PA 132 GJ19860-PA 1..132 1..132 575 82.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15830-PA 135 GK15830-PA 1..135 1..132 537 75.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21896-PA 132 GE21896-PA 1..132 1..132 658 97 Plus