BDGP Sequence Production Resources |
Search the DGRC for IP05962
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 59 |
Well: | 62 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15863-RA |
Protein status: | IP05962.pep: gold |
Preliminary Size: | 399 |
Sequenced Size: | 550 |
Gene | Date | Evidence |
---|---|---|
CG15863 | 2005-01-01 | Successful iPCR screen |
CG15863 | 2008-04-29 | Release 5.5 accounting |
CG15863 | 2008-08-15 | Release 5.9 accounting |
CG15863 | 2008-12-18 | 5.12 accounting |
550 bp (550 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023615
> IP05962.complete TTTGAAGAAATATCATTTGCAAAATGTCGCAAACAGATCTGAACAAAAGT ATTGAGATAATAACCAAGACCGAGGAGTTGGCCGACAAAATTCTGGTCAA CAAGCAGGAACTGACGGTAATGGATAAACGCCGCCAAGAAACCCGGCAGG CAATGCGGCTGATGGAGAAGTCGGAGGACAAGAAAGTTTGGATCACTATT GGCAGTATGCTAGTCAAAATGGAGCGGGAAAAGGCATTGGAACTGCTCAA AAAAGATCAACAGAAAATAGAACAGCAAATCAATCTGATATACTCAGATC AGAAAGTTCTGGTGAACAAACATCGCGATTTGGAGTTCAAATCGCCCTTC TCGGGTACACATCTTAAGCCCTTAGAAAAGAAGGAGTTCGACGCTCTGAA AGCAAATCTCCCATTACTGTGAAAATCTTCATTTAAGTAAATTTTAGTGA CCTAAACCTTGAATGCAACATGACCCAAAAAAAAAGATCCGCATTAGCGA GGTATATAAAGTAAACAATTTTGTATTAATAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5846647..5846919 | 256..530 | 99 | <- | Minus |
chr2R | 5846972..5847226 | 1..255 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 196..723 | 1..530 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 35..562 | 1..530 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 1..399 | 24..422 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15863-RA | 35..562 | 1..530 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9959119..9959391 | 256..530 | 99 | <- | Minus |
2R | 9959444..9959698 | 1..255 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9959119..9959391 | 256..530 | 99 | <- | Minus |
2R | 9959444..9959698 | 1..255 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9959119..9959391 | 256..530 | 99 | <- | Minus |
2R | 9959444..9959698 | 1..255 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5846624..5846896 | 256..530 | 99 | <- | Minus |
arm_2R | 5846949..5847203 | 1..255 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9960318..9960590 | 256..530 | 99 | <- | Minus |
2R | 9960643..9960897 | 1..255 | 100 | Minus |
Translation from 23 to 421
> IP05962.hyp MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEKS EDKKVWITIGSMLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKH RDLEFKSPFSGTHLKPLEKKEFDALKANLPLL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15863-PA | 132 | CG15863-PA | 1..132 | 1..132 | 653 | 100 | Plus |
Translation from 23 to 421
> IP05962.pep MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEKS EDKKVWITIGSMLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKH RDLEFKSPFSGTHLKPLEKKEFDALKANLPLL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11299-PA | 132 | GF11299-PA | 1..132 | 1..132 | 586 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25244-PA | 132 | GG25244-PA | 1..132 | 1..132 | 644 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21640-PA | 132 | GH21640-PA | 1..132 | 1..132 | 557 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15863-PA | 132 | CG15863-PA | 1..132 | 1..132 | 653 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20093-PA | 132 | GI20093-PA | 1..132 | 1..132 | 575 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17705-PA | 131 | GL17705-PA | 1..131 | 1..131 | 533 | 77.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13989-PA | 131 | GA13989-PA | 1..131 | 1..131 | 529 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20565-PA | 132 | GM20565-PA | 1..132 | 1..132 | 650 | 97 | Plus |
Dsec\GM26744-PA | 80 | GM26744-PA | 1..80 | 53..132 | 391 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10036-PA | 132 | GD10036-PA | 1..132 | 1..132 | 651 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19860-PA | 132 | GJ19860-PA | 1..132 | 1..132 | 575 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15830-PA | 135 | GK15830-PA | 1..135 | 1..132 | 537 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21896-PA | 132 | GE21896-PA | 1..132 | 1..132 | 658 | 97 | Plus |