Clone IP05980 Report

Search the DGRC for IP05980

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:80
Vector:pOT2
Associated Gene/TranscriptCG18577-RA
Protein status:IP05980.pep: gold
Preliminary Size:345
Sequenced Size:813

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18577 2005-01-01 Successful iPCR screen
CG18577 2008-04-29 Release 5.5 accounting
CG18577 2008-08-15 Release 5.9 accounting
CG18577 2008-12-18 5.12 accounting

Clone Sequence Records

IP05980.complete Sequence

813 bp (813 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023616

> IP05980.complete
AAATGTCGTCGTGGGTTGTCTCCACCACCGAGCTGCGCGATTGTGGTACC
AAAGGCTCCAAAGCCTCATCCACCTCGTCGCGGCACACGCGTCTGATCCT
GCTGGTGTGGCAGAATCTCGCCGAGAAGTGCCACAAATTCGGAAGTTTTC
TCCGGCGTGAAACGAATAAACCGCTGCCCAAAGAACTGAGGCGATCGTTA
CGTCTTAACAAATCGGCCCGCCGGAAAGGCTATCGGAGTTGCGAGAGCGA
AGCAGAAAAACGGCTGATGACAGAGCGTTTAAACGAACCCATCAACATCT
CCATTCGCATGGGACCTGCCTATGACTATAGGCCATCGAATTTCTGATCG
TTCGGGATTATTATATAAGGATAAAGTTCTTCGAATTTCTTAGCTCTGCT
AACTGCTAACTTAGCTTAAGATGTAATGTTACTGCTAAGTTGCCAATGTA
AACTGTTATTAAAAGTTTTTACGCAGCCTTACACGAATGTCGTAAGCTCT
GCGACAGCTGATGAAATCAAAGAGCTTTACAAGCAACGAAAGCTCTGGTT
CGCTCTTAACGACACACATGAGTTCTCTTAAGCTCTGCTCTTACTACGCC
CACTCAAAAGTTTATTGCCACAACAAGTGGACGTGACTTTGTGCATCACA
AACAGAGTATATTAGCTTTTTTAAAAAGTATAAGTTACATGTAATTATAA
AAATTGGTTTTGCTAAGCACTACAAACTTACCGCATTAATTTTTGCATAT
AATGCATATAATAAAAAAAAAACAAAATAAACATTTTAAAACACAAAAAA
AAAAAAAAAAAAA

IP05980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18577-RA 936 CG18577-RA 139..936 1..797 3950 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7022309..7022848 262..794 2510 98.5 Plus
chr3R 27901430 chr3R 7021664..7021926 1..263 1270 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11196749..11197285 262..797 2635 99.8 Plus
3R 32079331 3R 11196104..11196366 1..263 1315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10937580..10938116 262..797 2645 99.8 Plus
3R 31820162 3R 10936935..10937197 1..263 1315 100 Plus
Blast to na_te.dros performed 2019-03-16 02:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 254..287 758..791 107 79.4 Plus

IP05980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:16:18 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7021664..7021925 1..262 98 -> Plus
chr3R 7022310..7022804 263..753 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:44 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..345 3..347 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:01 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..345 3..347 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:55 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..345 3..347 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:27 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..345 3..347 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:02:34 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..345 3..347 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:35:30 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..795 1..794 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:01 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..795 1..794 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:55 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 13..807 1..794 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:27 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 1..793 3..794 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:02:34 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
CG18577-RA 13..807 1..794 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:18 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11196104..11196365 1..262 100 -> Plus
3R 11196750..11197282 263..794 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:18 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11196104..11196365 1..262 100 -> Plus
3R 11196750..11197282 263..794 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:18 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11196104..11196365 1..262 100 -> Plus
3R 11196750..11197282 263..794 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:55 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7021826..7022087 1..262 100 -> Plus
arm_3R 7022472..7023004 263..794 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:02 Download gff for IP05980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10936935..10937196 1..262 100 -> Plus
3R 10937581..10938113 263..794 99   Plus

IP05980.hyp Sequence

Translation from 2 to 346

> IP05980.hyp
MSSWVVSTTELRDCGTKGSKASSTSSRHTRLILLVWQNLAEKCHKFGSFL
RRETNKPLPKELRRSLRLNKSARRKGYRSCESEAEKRLMTERLNEPINIS
IRMGPAYDYRPSNF*

IP05980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG18577-PA 114 CG18577-PA 1..114 1..114 593 100 Plus

IP05980.pep Sequence

Translation from 2 to 346

> IP05980.pep
MSSWVVSTTELRDCGTKGSKASSTSSRHTRLILLVWQNLAEKCHKFGSFL
RRETNKPLPKELRRSLRLNKSARRKGYRSCESEAEKRLMTERLNEPINIS
IRMGPAYDYRPSNF*

IP05980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16736-PA 114 GF16736-PA 1..114 1..114 479 77.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17936-PA 114 GG17936-PA 1..114 1..114 535 89.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18174-PA 112 GH18174-PA 1..112 1..114 370 61.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG18577-PA 114 CG18577-PA 1..114 1..114 593 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10124-PA 112 GI10124-PA 1..111 1..113 381 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12562-PA 114 GL12562-PA 1..113 1..113 463 77 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14997-PA 114 GA14997-PA 1..113 1..113 463 77 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23922-PA 114 GM23922-PA 1..114 1..114 549 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18735-PA 114 GD18735-PA 1..114 1..114 560 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23346-PA 112 GJ23346-PA 1..112 1..114 378 64 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14005-PA 120 GK14005-PA 1..120 1..114 427 65 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26076-PA 117 GE26076-PA 1..116 1..113 519 87.9 Plus