BDGP Sequence Production Resources |
Search the DGRC for IP05980
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 59 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | CG18577-RA |
Protein status: | IP05980.pep: gold |
Preliminary Size: | 345 |
Sequenced Size: | 813 |
Gene | Date | Evidence |
---|---|---|
CG18577 | 2005-01-01 | Successful iPCR screen |
CG18577 | 2008-04-29 | Release 5.5 accounting |
CG18577 | 2008-08-15 | Release 5.9 accounting |
CG18577 | 2008-12-18 | 5.12 accounting |
813 bp (813 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023616
> IP05980.complete AAATGTCGTCGTGGGTTGTCTCCACCACCGAGCTGCGCGATTGTGGTACC AAAGGCTCCAAAGCCTCATCCACCTCGTCGCGGCACACGCGTCTGATCCT GCTGGTGTGGCAGAATCTCGCCGAGAAGTGCCACAAATTCGGAAGTTTTC TCCGGCGTGAAACGAATAAACCGCTGCCCAAAGAACTGAGGCGATCGTTA CGTCTTAACAAATCGGCCCGCCGGAAAGGCTATCGGAGTTGCGAGAGCGA AGCAGAAAAACGGCTGATGACAGAGCGTTTAAACGAACCCATCAACATCT CCATTCGCATGGGACCTGCCTATGACTATAGGCCATCGAATTTCTGATCG TTCGGGATTATTATATAAGGATAAAGTTCTTCGAATTTCTTAGCTCTGCT AACTGCTAACTTAGCTTAAGATGTAATGTTACTGCTAAGTTGCCAATGTA AACTGTTATTAAAAGTTTTTACGCAGCCTTACACGAATGTCGTAAGCTCT GCGACAGCTGATGAAATCAAAGAGCTTTACAAGCAACGAAAGCTCTGGTT CGCTCTTAACGACACACATGAGTTCTCTTAAGCTCTGCTCTTACTACGCC CACTCAAAAGTTTATTGCCACAACAAGTGGACGTGACTTTGTGCATCACA AACAGAGTATATTAGCTTTTTTAAAAAGTATAAGTTACATGTAATTATAA AAATTGGTTTTGCTAAGCACTACAAACTTACCGCATTAATTTTTGCATAT AATGCATATAATAAAAAAAAAACAAAATAAACATTTTAAAACACAAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18577-RA | 936 | CG18577-RA | 139..936 | 1..797 | 3950 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\HeT-A | 5691 | Dyak\HeT-A YAKHETA 5691bp | 254..287 | 758..791 | 107 | 79.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7021664..7021925 | 1..262 | 98 | -> | Plus |
chr3R | 7022310..7022804 | 263..753 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..345 | 3..347 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..345 | 3..347 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..345 | 3..347 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..345 | 3..347 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..345 | 3..347 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..795 | 1..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..795 | 1..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 13..807 | 1..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 1..793 | 3..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18577-RA | 13..807 | 1..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11196104..11196365 | 1..262 | 100 | -> | Plus |
3R | 11196750..11197282 | 263..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11196104..11196365 | 1..262 | 100 | -> | Plus |
3R | 11196750..11197282 | 263..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11196104..11196365 | 1..262 | 100 | -> | Plus |
3R | 11196750..11197282 | 263..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7021826..7022087 | 1..262 | 100 | -> | Plus |
arm_3R | 7022472..7023004 | 263..794 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10936935..10937196 | 1..262 | 100 | -> | Plus |
3R | 10937581..10938113 | 263..794 | 99 | Plus |
Translation from 2 to 346
> IP05980.hyp MSSWVVSTTELRDCGTKGSKASSTSSRHTRLILLVWQNLAEKCHKFGSFL RRETNKPLPKELRRSLRLNKSARRKGYRSCESEAEKRLMTERLNEPINIS IRMGPAYDYRPSNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18577-PA | 114 | CG18577-PA | 1..114 | 1..114 | 593 | 100 | Plus |
Translation from 2 to 346
> IP05980.pep MSSWVVSTTELRDCGTKGSKASSTSSRHTRLILLVWQNLAEKCHKFGSFL RRETNKPLPKELRRSLRLNKSARRKGYRSCESEAEKRLMTERLNEPINIS IRMGPAYDYRPSNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16736-PA | 114 | GF16736-PA | 1..114 | 1..114 | 479 | 77.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17936-PA | 114 | GG17936-PA | 1..114 | 1..114 | 535 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18174-PA | 112 | GH18174-PA | 1..112 | 1..114 | 370 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18577-PA | 114 | CG18577-PA | 1..114 | 1..114 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10124-PA | 112 | GI10124-PA | 1..111 | 1..113 | 381 | 63.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12562-PA | 114 | GL12562-PA | 1..113 | 1..113 | 463 | 77 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14997-PA | 114 | GA14997-PA | 1..113 | 1..113 | 463 | 77 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23922-PA | 114 | GM23922-PA | 1..114 | 1..114 | 549 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18735-PA | 114 | GD18735-PA | 1..114 | 1..114 | 560 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23346-PA | 112 | GJ23346-PA | 1..112 | 1..114 | 378 | 64 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14005-PA | 120 | GK14005-PA | 1..120 | 1..114 | 427 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26076-PA | 117 | GE26076-PA | 1..116 | 1..113 | 519 | 87.9 | Plus |