BDGP Sequence Production Resources |
Search the DGRC for IP05993
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 59 |
Well: | 93 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30441-RB |
Protein status: | IP05993.pep: gold |
Preliminary Size: | 396 |
Sequenced Size: | 427 |
Gene | Date | Evidence |
---|---|---|
CG30441 | 2005-01-01 | Successful iPCR screen |
CG30441 | 2008-04-29 | Release 5.5 accounting |
CG30441 | 2008-08-15 | Release 5.9 accounting |
CG30441 | 2008-12-18 | 5.12 accounting |
427 bp (427 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023613
> IP05993.complete AATAAGATGGAAGAACTTCAAAAAGTTGGTGTGTTTATAGATGAAATTTA CACGGTGCGAGTTGAGCATCCAAACCTTTCCAGTAGCAAAATAATGTTTA AACAAGAATGCTTCAACTACATTAAAGCATTCACTATTTTTAAAAAGTTT GTGTTTAATTATTGTAATATTTCTGAAACGTTTGCCAAAGATGTCGATAA GGAAAAACTACGCGCTATTGGTACTCAAAATCAATTAAAAACGGCATTTA TTCAGCGCCAGAACAAGCAGCAAGTCTATCAATATGAGATATTTGAGCAA ACAGTAGAACTTGAACGCTTAAAAGGCGAATTGCAGTTTTTACAGCGAAT TGAAACGGAGCAACATGAAATAATAAACAATTTTTTTGTCAATCAATATT AAAATTAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 1239133..1239538 | 406..1 | 2030 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 5351714..5352122 | 409..1 | 2045 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 5352913..5353321 | 409..1 | 2045 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 1239133..1239538 | 1..406 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..396 | 7..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..396 | 7..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..396 | 7..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..396 | 7..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..396 | 7..402 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30441-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 5351717..5352122 | 1..406 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 5351717..5352122 | 1..406 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 5351717..5352122 | 1..406 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 1239222..1239627 | 1..406 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 5352916..5353321 | 1..406 | 100 | Minus |
Translation from 0 to 401
> IP05993.hyp NKMEELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKF VFNYCNISETFAKDVDKEKLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQ TVELERLKGELQFLQRIETEQHEIINNFFVNQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30441-PB | 131 | CG30441-PB | 1..131 | 3..133 | 674 | 100 | Plus |
Translation from 6 to 401
> IP05993.pep MEELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVF NYCNISETFAKDVDKEKLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTV ELERLKGELQFLQRIETEQHEIINNFFVNQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19927-PA | 130 | GF19927-PA | 1..130 | 1..130 | 317 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10864-PA | 131 | GG10864-PA | 1..131 | 1..131 | 620 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23730-PA | 130 | GH23730-PA | 1..130 | 1..130 | 413 | 61.5 | Plus |
Dgri\GH20159-PA | 130 | GH20159-PA | 1..130 | 1..130 | 413 | 61.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IFT20-PB | 131 | CG30441-PB | 1..131 | 1..131 | 674 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20669-PA | 130 | GI20669-PA | 1..130 | 1..130 | 379 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11048-PA | 130 | GL11048-PA | 1..130 | 1..130 | 385 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15848-PA | 130 | GA15848-PA | 1..130 | 1..130 | 385 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11093-PA | 131 | GM11093-PA | 1..131 | 1..131 | 650 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10361-PA | 131 | GD10361-PA | 1..131 | 1..131 | 656 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20418-PA | 130 | GJ20418-PA | 1..130 | 1..130 | 403 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21369-PA | 138 | GK21369-PA | 15..138 | 7..130 | 383 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11244-PA | 131 | GE11244-PA | 1..131 | 1..131 | 598 | 89.3 | Plus |