Clone IP05993 Report

Search the DGRC for IP05993

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:59
Well:93
Vector:pOT2
Associated Gene/TranscriptCG30441-RB
Protein status:IP05993.pep: gold
Preliminary Size:396
Sequenced Size:427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30441 2005-01-01 Successful iPCR screen
CG30441 2008-04-29 Release 5.5 accounting
CG30441 2008-08-15 Release 5.9 accounting
CG30441 2008-12-18 5.12 accounting

Clone Sequence Records

IP05993.complete Sequence

427 bp (427 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023613

> IP05993.complete
AATAAGATGGAAGAACTTCAAAAAGTTGGTGTGTTTATAGATGAAATTTA
CACGGTGCGAGTTGAGCATCCAAACCTTTCCAGTAGCAAAATAATGTTTA
AACAAGAATGCTTCAACTACATTAAAGCATTCACTATTTTTAAAAAGTTT
GTGTTTAATTATTGTAATATTTCTGAAACGTTTGCCAAAGATGTCGATAA
GGAAAAACTACGCGCTATTGGTACTCAAAATCAATTAAAAACGGCATTTA
TTCAGCGCCAGAACAAGCAGCAAGTCTATCAATATGAGATATTTGAGCAA
ACAGTAGAACTTGAACGCTTAAAAGGCGAATTGCAGTTTTTACAGCGAAT
TGAAACGGAGCAACATGAAATAATAAACAATTTTTTTGTCAATCAATATT
AAAATTAAAAAAAAAAAAAAAAAAAAA

IP05993.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG30441-RB 410 CG30441-RB 1..409 1..409 2045 100 Plus
CG10395-RA 1454 CG10395-RA 1164..1454 409..119 1455 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1239133..1239538 406..1 2030 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5351714..5352122 409..1 2045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5352913..5353321 409..1 2045 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:32:01 has no hits.

IP05993.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:40 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1239133..1239538 1..406 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:46 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..396 7..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:48 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..396 7..402 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:45 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..396 7..402 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:33 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..396 7..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:32 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..396 7..402 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:54 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:48 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:45 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:33 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:32 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
CG30441-RB 1..406 1..406 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:40 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5351717..5352122 1..406 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:40 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5351717..5352122 1..406 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:40 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5351717..5352122 1..406 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:45 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1239222..1239627 1..406 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:18:16 Download gff for IP05993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5352916..5353321 1..406 100   Minus

IP05993.hyp Sequence

Translation from 0 to 401

> IP05993.hyp
NKMEELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKF
VFNYCNISETFAKDVDKEKLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQ
TVELERLKGELQFLQRIETEQHEIINNFFVNQY*

IP05993.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG30441-PB 131 CG30441-PB 1..131 3..133 674 100 Plus

IP05993.pep Sequence

Translation from 6 to 401

> IP05993.pep
MEELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVF
NYCNISETFAKDVDKEKLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTV
ELERLKGELQFLQRIETEQHEIINNFFVNQY*

IP05993.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19927-PA 130 GF19927-PA 1..130 1..130 317 52.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10864-PA 131 GG10864-PA 1..131 1..131 620 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23730-PA 130 GH23730-PA 1..130 1..130 413 61.5 Plus
Dgri\GH20159-PA 130 GH20159-PA 1..130 1..130 413 61.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
IFT20-PB 131 CG30441-PB 1..131 1..131 674 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20669-PA 130 GI20669-PA 1..130 1..130 379 59.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11048-PA 130 GL11048-PA 1..130 1..130 385 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15848-PA 130 GA15848-PA 1..130 1..130 385 58.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11093-PA 131 GM11093-PA 1..131 1..131 650 95.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10361-PA 131 GD10361-PA 1..131 1..131 656 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20418-PA 130 GJ20418-PA 1..130 1..130 403 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21369-PA 138 GK21369-PA 15..138 7..130 383 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11244-PA 131 GE11244-PA 1..131 1..131 598 89.3 Plus