Clone IP06001 Report

Search the DGRC for IP06001

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:60
Well:1
Vector:pOT2
Associated Gene/TranscriptCG31230-RA
Protein status:IP06001.pep: gold
Preliminary Size:369
Sequenced Size:425

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31230 2005-01-01 Successful iPCR screen
CG31230 2008-04-29 Release 5.5 accounting
CG31230 2008-08-15 Release 5.9 accounting
CG31230 2008-12-18 5.12 accounting

Clone Sequence Records

IP06001.complete Sequence

425 bp (425 high quality bases) assembled on 2006-03-08

GenBank Submission: BT025004

> IP06001.complete
TGAACATGTTTTGCCACAAATTTATCTCAAGTCTTCAAGACACATGAAAG
CAGCAATAGTACGGATACCAATCGGAATTTACTTCAAAACCCTAATGAAG
ATGAACAGAAATCGTGGGGATCGTTGGAGAAAGATGGCCGAGCTCGTATT
CTCCTTATGTGTGATTGACAAAGCCGAGGATGTAGTTCTTGATGTTATTA
TGTTAAAGTTCCTCGGAGAGTAGTTGCAGCGAACCAAACTAGACGCATCT
ATGTAGAATATGGCTGACCGAATCTACTATATCAATCAATGTTATCTTAC
TAGAACCCATATGTTCCATAGAATGCTAATGTAAAATATATACTTGATTA
ATTATATAAATATTTATTGCGGTGTACACAGACCAACGATCGATGACAGA
ATAAAAAAAAAAAAAAAAAAAAAAA

IP06001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-RA 416 CG31230-RA 15..416 1..402 2010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14495804..14496205 1..402 1995 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18671693..18672096 1..404 2020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18412524..18412927 1..404 2020 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:10:08 has no hits.

IP06001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-15 12:11:21 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:47 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 44..223 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:34 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 44..223 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:38:08 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 44..223 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:35 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 44..223 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:52:51 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 44..223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:39 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 15..369 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:34 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 15..416 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:38:08 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 15..416 1..402 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:35 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 15..369 1..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:52:51 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 15..416 1..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18671693..18672094 1..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18671693..18672094 1..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18671693..18672094 1..402 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:38:08 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14497415..14497816 1..402 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:38 Download gff for IP06001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18412524..18412925 1..402 100   Plus

IP06001.hyp Sequence

Translation from 0 to 222

> IP06001.hyp
EHVLPQIYLKSSRHMKAAIVRIPIGIYFKTLMKMNRNRGDRWRKMAELVF
SLCVIDKAEDVVLDVIMLKFLGE*

IP06001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-PA 59 CG31230-PA 1..59 15..73 298 100 Plus

IP06001.pep Sequence

Translation from 43 to 222

> IP06001.pep
MKAAIVRIPIGIYFKTLMKMNRNRGDRWRKMAELVFSLCVIDKAEDVVLD
VIMLKFLGE*

IP06001.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-PA 59 CG31230-PA 1..59 1..59 298 100 Plus