IP06001.complete Sequence
425 bp (425 high quality bases) assembled on 2006-03-08
GenBank Submission: BT025004
> IP06001.complete
TGAACATGTTTTGCCACAAATTTATCTCAAGTCTTCAAGACACATGAAAG
CAGCAATAGTACGGATACCAATCGGAATTTACTTCAAAACCCTAATGAAG
ATGAACAGAAATCGTGGGGATCGTTGGAGAAAGATGGCCGAGCTCGTATT
CTCCTTATGTGTGATTGACAAAGCCGAGGATGTAGTTCTTGATGTTATTA
TGTTAAAGTTCCTCGGAGAGTAGTTGCAGCGAACCAAACTAGACGCATCT
ATGTAGAATATGGCTGACCGAATCTACTATATCAATCAATGTTATCTTAC
TAGAACCCATATGTTCCATAGAATGCTAATGTAAAATATATACTTGATTA
ATTATATAAATATTTATTGCGGTGTACACAGACCAACGATCGATGACAGA
ATAAAAAAAAAAAAAAAAAAAAAAA
IP06001.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:50:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31230-RA | 416 | CG31230-RA | 15..416 | 1..402 | 2010 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:10:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 14495804..14496205 | 1..402 | 1995 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:10:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18671693..18672096 | 1..404 | 2020 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 18412524..18412927 | 1..404 | 2020 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 12:10:08 has no hits.
IP06001.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed on 2019-03-15 12:11:21 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:47 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 1..180 | 44..223 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:34 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 1..180 | 44..223 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:38:08 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 1..180 | 44..223 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:35 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 1..180 | 44..223 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:52:51 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 1..180 | 44..223 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:39 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 15..369 | 1..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:34 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 15..416 | 1..402 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:38:08 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 15..416 | 1..402 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:35 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 15..369 | 1..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:52:51 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31230-RA | 15..416 | 1..402 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18671693..18672094 | 1..402 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18671693..18672094 | 1..402 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:21 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18671693..18672094 | 1..402 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:38:08 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14497415..14497816 | 1..402 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:38 Download gff for
IP06001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18412524..18412925 | 1..402 | 100 | | Plus |
IP06001.hyp Sequence
Translation from 0 to 222
> IP06001.hyp
EHVLPQIYLKSSRHMKAAIVRIPIGIYFKTLMKMNRNRGDRWRKMAELVF
SLCVIDKAEDVVLDVIMLKFLGE*
IP06001.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31230-PA | 59 | CG31230-PA | 1..59 | 15..73 | 298 | 100 | Plus |
IP06001.pep Sequence
Translation from 43 to 222
> IP06001.pep
MKAAIVRIPIGIYFKTLMKMNRNRGDRWRKMAELVFSLCVIDKAEDVVLD
VIMLKFLGE*
IP06001.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31230-PA | 59 | CG31230-PA | 1..59 | 1..59 | 298 | 100 | Plus |