Clone IP06005 Report

Search the DGRC for IP06005

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:60
Well:5
Vector:pOT2
Associated Gene/TranscriptAcp24A4-RB
Protein status:IP06005.pep: gold
Preliminary Size:324
Sequenced Size:365

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31779 2005-01-01 Successful iPCR screen
Acp24A4 2008-04-29 Release 5.5 accounting
Acp24A4 2008-08-15 Release 5.9 accounting
Acp24A4 2008-12-18 5.12 accounting

Clone Sequence Records

IP06005.complete Sequence

365 bp (365 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022473

> IP06005.complete
TCAGTTAAAGGTTCCCAATATCTTTCGCCATGAAGCTGCTGATTCTTCTT
TTTGTTTTCATCGCTCTTGCAAGCAATTCTTTGGCTCTGAAAAATGAAAT
CTGTGGATTACCCGCTGCCGCTAATGGTAATTGCTTGGCATTGTTTTCTC
GCTGGTCTTATGATGCTCAATATAACGTATGCTTTAATTTTATCTACGGC
GGATGTCAGGGCAACGAAAATTCATTTGAATCCCAGGAAGAGTGTATAAA
TAAGTGCGTGGAGTAATATCTCTACGAAGATATCTGTATCTATGATCTGA
ATGTATGCGTACGAAACACAAGAAACATTTAGTTAGCCTTACAAAAAAAA
AAAAAAAAAAAAAAA

IP06005.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Acp24A4-RB 342 Acp24A4-RB 1..342 1..342 1710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3693003..3693249 342..96 1235 100 Minus
chr2L 23010047 chr2L 3693318..3693413 96..1 480 100 Minus
chr2L 23010047 chr2L 3693610..3693799 285..96 335 78.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3693476..3693725 345..96 1250 100 Minus
2L 23513712 2L 3693794..3693889 96..1 480 100 Minus
2L 23513712 2L 3694086..3694275 285..96 335 78.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3693476..3693725 345..96 1250 100 Minus
2L 23513712 2L 3693794..3693889 96..1 480 100 Minus
2L 23513712 2L 3694086..3694192 285..179 310 85.9 Minus
Blast to na_te.dros performed on 2019-03-16 02:22:22 has no hits.

IP06005.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:23:22 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3693003..3693248 97..342 100 <- Minus
chr2L 3693318..3693413 1..96 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:49 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..237 30..266 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:54 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..237 30..266 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:40 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..237 30..266 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:43 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..237 30..266 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:27 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..237 30..266 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:58 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..342 1..342 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:54 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..342 1..342 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:40 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..342 1..342 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:43 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..342 1..342 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:27 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RB 1..342 1..342 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:23:22 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693479..3693724 97..342 100 <- Minus
2L 3693794..3693889 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:23:22 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693479..3693724 97..342 100 <- Minus
2L 3693794..3693889 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:23:22 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693479..3693724 97..342 100 <- Minus
2L 3693794..3693889 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:40 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3693479..3693724 97..342 100 <- Minus
arm_2L 3693794..3693889 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:49 Download gff for IP06005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693479..3693724 97..342 100 <- Minus
2L 3693794..3693889 1..96 100   Minus

IP06005.hyp Sequence

Translation from 29 to 265

> IP06005.hyp
MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNV
CFNFIYGGCQGNENSFESQEECINKCVE*

IP06005.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Acp24A4-PC 78 CG31779-PC 1..78 1..78 417 100 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..78 417 100 Plus
CG16713-PA 82 CG16713-PA 1..82 1..78 245 57.3 Plus
CG16712-PB 82 CG16712-PB 1..82 1..78 184 46.3 Plus
CG16712-PA 82 CG16712-PA 1..82 1..78 184 46.3 Plus

IP06005.pep Sequence

Translation from 29 to 265

> IP06005.pep
MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNV
CFNFIYGGCQGNENSFESQEECINKCVE*

IP06005.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14655-PA 81 GF14655-PA 1..81 1..78 193 48.1 Plus
Dana\GF19682-PA 82 GF19682-PA 1..82 1..78 187 50 Plus
Dana\GF14654-PA 82 GF14654-PA 1..82 1..78 160 41.5 Plus
Dana\GF15247-PA 82 GF15247-PA 17..82 17..78 139 42.4 Plus
Dana\GF19702-PA 53 GF19702-PA 1..52 24..76 136 49.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24417-PA 78 GG24417-PA 1..78 1..78 294 71.8 Plus
Dere\GG24416-PA 78 GG24416-PA 1..78 1..78 261 65.4 Plus
Dere\GG24411-PA 78 GG24411-PA 1..78 1..78 253 64.1 Plus
Dere\GG24413-PA 82 GG24413-PA 1..82 1..78 203 51.2 Plus
Dere\GG24412-PA 82 GG24412-PA 1..82 1..78 174 45.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13180-PA 81 GH13180-PA 1..81 1..77 191 46.9 Plus
Dgri\GH25268-PA 83 GH25268-PA 1..82 1..77 149 42.7 Plus
Dgri\GH22481-PA 83 GH22481-PA 1..82 1..77 146 42.7 Plus
Dgri\GH13181-PA 83 GH13181-PA 1..82 1..77 146 42.7 Plus
Dgri\GH22482-PA 86 GH22482-PA 35..84 26..76 142 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Acp24A4-PC 78 CG31779-PC 1..78 1..78 417 100 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..78 417 100 Plus
CG16713-PA 82 CG16713-PA 1..82 1..78 245 57.3 Plus
IM33-PB 82 CG16712-PB 1..82 1..78 184 46.3 Plus
IM33-PA 82 CG16712-PA 1..82 1..78 184 46.3 Plus
CG43165-PA 95 CG43165-PA 1..80 1..76 184 46.2 Plus
CG16704-PB 79 CG16704-PB 1..77 1..76 157 40.3 Plus
CG16704-PA 79 CG16704-PA 1..77 1..76 157 40.3 Plus
CG17380-PB 119 CG17380-PB 1..75 1..76 153 40.8 Plus
CG13748-PA 113 CG13748-PA 58..110 23..76 139 44.4 Plus
CG3604-PB 132 CG3604-PB 62..106 33..77 139 48.9 Plus
CG3604-PA 132 CG3604-PA 62..106 33..77 139 48.9 Plus
CG42464-PA 87 CG42464-PA 7..80 8..76 136 42.7 Plus
CG3513-PA 88 CG3513-PA 25..86 21..76 136 40.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23877-PA 82 GI23877-PA 1..82 1..78 208 52.4 Plus
Dmoj\GI17757-PA 82 GI17757-PA 1..82 1..78 188 50 Plus
Dmoj\GI17758-PA 82 GI17758-PA 1..82 1..78 176 45.1 Plus
Dmoj\GI17759-PA 82 GI17759-PA 18..82 18..78 169 50.8 Plus
Dmoj\GI17761-PA 64 GI17761-PA 5..62 19..76 132 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19461-PA 78 GL19461-PA 1..78 1..78 210 57.7 Plus
Dper\GL19460-PA 80 GL19460-PA 1..80 1..78 198 52.4 Plus
Dper\GL19427-PA 78 GL19427-PA 1..78 1..78 181 43.6 Plus
Dper\GL19462-PA 82 GL19462-PA 1..82 1..78 180 50 Plus
Dper\GL19459-PA 82 GL19459-PA 1..82 1..78 177 46.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25970-PA 78 GA25970-PA 1..78 1..78 207 57.7 Plus
Dpse\GA25969-PA 80 GA25969-PA 1..80 1..78 200 52.4 Plus
Dpse\GA14098-PA 82 GA14098-PA 1..82 1..78 187 48.8 Plus
Dpse\GA25971-PA 82 GA25971-PA 1..82 1..78 179 50 Plus
Dpse\GA25956-PA 78 GA25956-PA 1..78 1..78 172 41 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18129-PA 107 GM18129-PA 31..107 2..78 249 61 Plus
Dsec\GM18128-PA 82 GM18128-PA 1..82 1..78 234 56.1 Plus
Dsec\GM18127-PA 82 GM18127-PA 1..82 1..78 179 46.3 Plus
Dsec\GM18131-PA 78 GM18131-PA 1..76 1..76 151 42.1 Plus
Dsec\GM18125-PA 130 GM18125-PA 51..104 23..77 136 45.5 Plus
Dsec\GM18129-PA 107 GM18129-PA 4..51 23..70 135 54.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp24A4-PA 78 GD22736-PA 1..78 1..78 348 85.9 Plus
Dsim\GD22735-PA 82 GD22735-PA 1..82 1..78 234 56.1 Plus
Dsim\GD22734-PA 82 GD22734-PA 1..82 1..78 181 46.3 Plus
Dsim\GD22733-PA 130 GD22733-PA 51..104 23..77 134 45.5 Plus
Dsim\GD22737-PA 88 GD22737-PA 6..88 4..78 131 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21125-PA 80 GJ21125-PA 1..80 1..78 211 51.2 Plus
Dvir\GJ17586-PA 82 GJ17586-PA 1..82 1..78 204 48.8 Plus
Dvir\GJ17585-PA 82 GJ17585-PA 1..82 1..78 196 50 Plus
Dvir\GJ16350-PA 79 GJ16350-PA 20..77 19..76 136 46.6 Plus
Dvir\GJ16348-PA 86 GJ16348-PA 1..86 1..78 130 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15469-PA 80 GK15469-PA 1..78 1..76 163 43.8 Plus
Dwil\GK18965-PA 79 GK18965-PA 1..77 1..76 157 39 Plus
Dwil\GK15472-PA 79 GK15472-PA 6..77 5..76 141 40.3 Plus
Dwil\GK15471-PA 90 GK15471-PA 10..90 7..78 137 38.3 Plus
Dwil\GK17987-PA 113 GK17987-PA 58..110 23..76 135 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14816-PA 82 GE14816-PA 1..82 1..78 234 53.7 Plus
Dyak\GE17972-PA 84 GE17972-PA 1..84 1..78 178 53.6 Plus
Dyak\GE14815-PA 82 GE14815-PA 1..82 1..78 154 42.7 Plus
Dyak\GE18825-PA 184 GE18825-PA 9..81 3..76 137 37.8 Plus
Dyak\GE14817-PA 106 GE14817-PA 18..106 2..78 135 38.2 Plus