Clone IP06044 Report

Search the DGRC for IP06044

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:60
Well:44
Vector:pOT2
Associated Gene/TranscriptCG6435-RA
Protein status:IP06044.pep: gold
Preliminary Size:384
Sequenced Size:778

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6435 2005-01-01 Successful iPCR screen
CG6435 2008-04-29 Release 5.5 accounting
CG6435 2008-08-15 Release 5.9 accounting
CG6435 2008-12-18 5.12 accounting

Clone Sequence Records

IP06044.complete Sequence

778 bp (778 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022481

> IP06044.complete
GCACTTGCAGGTCGGGTTCTCGATTCTCGATCGGATTCAAAGCTCAGTTA
TGCTACGATTGCTAGTTTGTTTGTGGCTACTGGTGTACAGTGGTTCCAGC
TATGAGGTGCAAAACAAACCCGTCACGGAAGATTGCCTAGACTGTCTATG
CGAAACAATGAGTGGCTGCAATGCATCCGCAATTTGCGTAAATGGGGCCT
GCGGTATATTCCGAATCACTTGGGGCTACTGGGTGGAGGCGGGCAAACTA
ACTTTGCCCACAGATACAGCTCTCTCCGAAGACGCTTTTACGAACTGCGT
TAATCAGCCCCACTGTGCAGCGAACACGGTGCAGAATTATATGTTCAAAC
ATGGCCAGGATTGCAATGGAGACGAGCACATCGATTGCCTGGATTTCGGA
GCACTCCACAAACTGGGCAATCTGAAGTGCCAGGAAGAGTTGCCCTACAT
CTTTGCCAAAGTCTTCAATCGATGTCTGAAATCCAAGGAGCGGATGGCAG
AGGAAAAGATCATCAAGGAGCAGGAAACGGTTTCAACATAATTGATTCTT
TATTGGGTTTCATCGTTTCCCACTTTTCGGGGATATATTTGTCTGTTTTT
AAAACAATCCTGGTAACACATATACACGTACATACATCGAAACATTGCTT
ATGTTTGCATTTGAACAGTTTCCAATATAGGTATGGATTCTATAGATTTA
GTTACAGATACAGATATATATATATAATATATATAGAGGGGTATATGAAA
ACTACTTTAAAAAAAAAAAAAAAAAAAA

IP06044.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6435-RA 794 CG6435-RA 8..767 1..760 3800 100 Plus
CG8910-RA 3405 CG8910-RA 3179..3405 760..534 1135 100 Minus
CG8910.a 3447 CG8910.a 3221..3447 760..534 1135 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12761635..12762109 284..758 2330 99.4 Plus
chr2R 21145070 chr2R 12761401..12761578 107..284 875 99.4 Plus
chr2R 21145070 chr2R 12760945..12761051 1..107 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16874474..16874950 284..760 2385 100 Plus
2R 25286936 2R 16874240..16874417 107..284 890 100 Plus
2R 25286936 2R 16873779..16873885 1..107 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16875673..16876149 284..760 2385 100 Plus
2R 25260384 2R 16875439..16875616 107..284 890 100 Plus
2R 25260384 2R 16874978..16875084 1..107 535 100 Plus
2R 25260384 2R 16873729..16873788 190..249 165 85 Plus
Blast to na_te.dros performed on 2019-03-16 05:34:48 has no hits.

IP06044.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:35:40 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12760945..12761051 1..107 100 -> Plus
chr2R 12761402..12761578 108..284 99 -> Plus
chr2R 12761636..12762109 285..758 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:28:55 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..492 50..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:58 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..492 50..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:19 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..492 50..541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:46 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..492 50..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:53 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..492 50..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:02:08 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:58 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:19 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 8..765 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:46 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:53 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6435-RA 8..765 1..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:40 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16874475..16874948 285..758 100   Plus
2R 16873779..16873885 1..107 100 -> Plus
2R 16874241..16874417 108..284 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:40 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16874475..16874948 285..758 100   Plus
2R 16873779..16873885 1..107 100 -> Plus
2R 16874241..16874417 108..284 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:40 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16874475..16874948 285..758 100   Plus
2R 16873779..16873885 1..107 100 -> Plus
2R 16874241..16874417 108..284 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:19 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12761980..12762453 285..758 100   Plus
arm_2R 12761284..12761390 1..107 100 -> Plus
arm_2R 12761746..12761922 108..284 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:53 Download gff for IP06044.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16875674..16876147 285..758 100   Plus
2R 16874978..16875084 1..107 100 -> Plus
2R 16875440..16875616 108..284 100 -> Plus

IP06044.hyp Sequence

Translation from 0 to 540

> IP06044.hyp
HLQVGFSILDRIQSSVMLRLLVCLWLLVYSGSSYEVQNKPVTEDCLDCLC
ETMSGCNASAICVNGACGIFRITWGYWVEAGKLTLPTDTALSEDAFTNCV
NQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHKLGNLKCQEELPYI
FAKVFNRCLKSKERMAEEKIIKEQETVST*

IP06044.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6435-PA 163 CG6435-PA 1..163 17..179 896 100 Plus
CG6429-PA 159 CG6429-PA 23..151 35..164 465 56.9 Plus
CG6426-PA 161 CG6426-PA 25..155 35..165 438 55.7 Plus
CG6421-PA 161 CG6421-PA 5..156 20..163 424 53.3 Plus
CG14823-PA 263 CG14823-PA 138..258 45..160 170 37.1 Plus

IP06044.pep Sequence

Translation from 49 to 540

> IP06044.pep
MLRLLVCLWLLVYSGSSYEVQNKPVTEDCLDCLCETMSGCNASAICVNGA
CGIFRITWGYWVEAGKLTLPTDTALSEDAFTNCVNQPHCAANTVQNYMFK
HGQDCNGDEHIDCLDFGALHKLGNLKCQEELPYIFAKVFNRCLKSKERMA
EEKIIKEQETVST*

IP06044.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11420-PA 166 GF11420-PA 1..166 1..163 695 78.9 Plus
Dana\GF11419-PA 158 GF11419-PA 4..154 1..153 449 53.6 Plus
Dana\GF11417-PA 161 GF11417-PA 25..155 19..149 406 54.2 Plus
Dana\GF11418-PA 161 GF11418-PA 25..148 19..139 375 57.3 Plus
Dana\GF25005-PA 264 GF25005-PA 139..261 22..146 186 34.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20642-PA 163 GG20642-PA 12..163 12..163 773 93.4 Plus
Dere\GG20641-PA 159 GG20641-PA 23..151 19..148 450 56.2 Plus
Dere\GG20638-PA 161 GG20638-PA 25..155 19..149 423 55.7 Plus
Dere\GG20639-PA 161 GG20639-PA 4..156 1..147 411 52.3 Plus
Dere\GG14400-PA 264 GG14400-PA 139..259 29..144 168 36.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22647-PA 157 GH22647-PA 14..151 16..153 560 70.3 Plus
Dgri\GH22644-PA 161 GH22644-PA 25..149 19..143 431 59.2 Plus
Dgri\GH22645-PA 163 GH22645-PA 26..159 20..150 407 55.2 Plus
Dgri\GH22646-PA 117 GH22646-PA 1..116 33..148 389 53.4 Plus
Dgri\GH15386-PA 226 GH15386-PA 106..224 22..147 165 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6435-PA 163 CG6435-PA 1..163 1..163 896 100 Plus
CG6429-PA 159 CG6429-PA 23..151 19..148 465 56.9 Plus
CG6426-PA 161 CG6426-PA 25..155 19..149 438 55.7 Plus
CG6421-PA 161 CG6421-PA 5..156 4..147 424 53.3 Plus
CG14823-PA 263 CG14823-PA 138..258 29..144 170 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21159-PA 145 GI21159-PA 9..138 19..152 489 64.9 Plus
Dmoj\GI21158-PA 158 GI21158-PA 7..152 5..148 456 52.1 Plus
Dmoj\GI21157-PA 190 GI21157-PA 31..187 4..156 428 52.5 Plus
Dmoj\GI12991-PA 230 GI12991-PA 113..228 28..147 177 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11567-PA 132 GL11567-PA 1..115 37..151 524 81.7 Plus
Dper\GL11566-PA 156 GL11566-PA 8..143 8..143 456 56.6 Plus
Dper\GL11565-PA 161 GL11565-PA 5..161 2..152 410 51.6 Plus
Dper\GL11564-PA 161 GL11564-PA 15..155 5..149 410 51.7 Plus
Dper\GL25021-PA 254 GL25021-PA 112..252 10..147 192 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19591-PA 132 GA19591-PA 1..115 37..151 528 81.7 Plus
Dpse\GA19586-PA 156 GA19586-PA 8..143 8..143 457 56.6 Plus
Dpse\GA19584-PA 161 GA19584-PA 15..155 5..149 410 51.7 Plus
Dpse\GA19580-PA 161 GA19580-PA 5..161 2..152 410 51.6 Plus
Dpse\GA13274-PA 254 GA13274-PA 134..251 28..146 184 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21736-PA 163 GM21736-PA 1..163 1..163 865 98.8 Plus
Dsec\GM21734-PA 159 GM21734-PA 23..151 19..148 449 56.2 Plus
Dsec\GM21731-PA 161 GM21731-PA 25..155 19..149 422 55.7 Plus
Dsec\GM21732-PA 91 GM21732-PA 25..78 19..69 197 68.5 Plus
Dsec\GM14814-PA 263 GM14814-PA 138..260 29..146 171 36.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11230-PA 163 GD11230-PA 1..163 1..163 871 99.4 Plus
Dsim\GD11229-PA 159 GD11229-PA 23..151 19..148 448 56.2 Plus
Dsim\GD11227-PA 161 GD11227-PA 26..156 20..147 407 58 Plus
Dsim\GD13989-PA 263 GD13989-PA 138..260 29..146 172 36.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21012-PA 154 GJ21012-PA 5..147 10..152 562 67.1 Plus
Dvir\GJ21011-PA 162 GJ21011-PA 27..151 23..147 469 59.2 Plus
Dvir\GJ21009-PA 161 GJ21009-PA 25..151 19..145 418 55.9 Plus
Dvir\GJ21010-PA 161 GJ21010-PA 28..154 22..145 413 59.1 Plus
Dvir\GJ21007-PA 145 GJ21007-PA 10..140 19..149 387 51.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22028-PA 172 GK22028-PA 16..165 6..153 577 68 Plus
Dwil\GK22027-PA 163 GK22027-PA 5..160 1..153 466 50.6 Plus
Dwil\GK22025-PA 161 GK22025-PA 25..151 19..145 411 54.3 Plus
Dwil\GK22026-PA 166 GK22026-PA 9..157 1..147 389 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11830-PA 164 GE11830-PA 1..161 1..161 851 98.1 Plus
Dyak\GE11829-PA 159 GE11829-PA 23..151 19..148 456 57.7 Plus
Dyak\GE11827-PA 161 GE11827-PA 25..155 19..149 421 55.7 Plus
Dyak\GE11828-PA 159 GE11828-PA 4..154 1..147 412 54.6 Plus
Dyak\GE21589-PA 262 GE21589-PA 137..257 29..144 170 37.1 Plus