Clone IP06110 Report

Search the DGRC for IP06110

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:61
Well:10
Vector:pOT2
Associated Gene/Transcriptedin-RA
Protein status:IP06110.pep: gold
Preliminary Size:348
Sequenced Size:447

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32185 2005-01-01 Successful iPCR screen
CG32185 2008-04-29 Release 5.5 accounting
CG32185 2008-08-15 Release 5.9 accounting
CG32185 2008-12-18 5.12 accounting

Clone Sequence Records

IP06110.complete Sequence

447 bp (447 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023614

> IP06110.complete
CCAGCAAAGATGTTCTCCAACAAGTGCGGAATACTGATCCTCGTGTCCTG
CTGTCTGGTGACAATAGTGGCCTCCTATCGTCAACCATATCCCGAGGAGT
TCCAGACCAGTCCAGAGCAGCTGCTCCAAGTGGCACCCTTGGTACGCCGT
GCTCGATCGCCTGAGGGAGGATCCGTGGTCGTAACCGCCAGCAAGGACAA
CCAAGTGGGTCGGGAGGCTAGTGTTCAGTACAACCACAATCTGTATAGTA
GTGGCGATGGGCGTGGCAGCATCGACGCCTACGCCCAGGCCAGTCGGAAT
TTCGACTACAATCGGAACAACTACGAAGGCGGCATTCGGGGCACCTGGCA
TTTCTGAGCGGGAACAGAAGTATTAAGTTGGTTACAACTTGATTCATGTG
AATAAATACGTGTGTTTACCCAAAAAAAAAAAAAAAAAAAAAAAAAA

IP06110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32185-RA 421 CG32185-RA 1..421 1..421 2105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17484411..17484831 1..421 2060 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17494880..17495302 1..423 2115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17487980..17488402 1..423 2115 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:12:35 has no hits.

IP06110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:13:16 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17484411..17484831 1..421 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:01 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:30 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:39:28 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
edin-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:34 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:54:55 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
edin-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:57 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:30 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:39:28 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
edin-RA 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:34 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32185-RA 1..348 10..357 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:54:55 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
edin-RA 1..421 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:13:16 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17494880..17495300 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:13:16 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17494880..17495300 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:13:16 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17494880..17495300 1..421 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:39:28 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17487980..17488400 1..421 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:18:58 Download gff for IP06110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17487980..17488400 1..421 100   Plus

IP06110.hyp Sequence

Translation from 0 to 356

> IP06110.hyp
PAKMFSNKCGILILVSCCLVTIVASYRQPYPEEFQTSPEQLLQVAPLVRR
ARSPEGGSVVVTASKDNQVGREASVQYNHNLYSSGDGRGSIDAYAQASRN
FDYNRNNYEGGIRGTWHF*

IP06110.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
edin-PA 115 CG32185-PA 1..115 4..118 607 100 Plus

IP06110.pep Sequence

Translation from 9 to 356

> IP06110.pep
MFSNKCGILILVSCCLVTIVASYRQPYPEEFQTSPEQLLQVAPLVRRARS
PEGGSVVVTASKDNQVGREASVQYNHNLYSSGDGRGSIDAYAQASRNFDY
NRNNYEGGIRGTWHF*

IP06110.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10536-PA 116 GF10536-PA 1..116 1..115 395 62.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13620-PA 116 GG13620-PA 1..116 1..115 425 69.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16191-PA 109 GH16191-PA 1..109 1..115 266 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
edin-PA 115 CG32185-PA 1..115 1..115 607 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15586-PA 109 GL15586-PA 1..109 1..115 364 60.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16743-PA 109 GA16743-PA 1..109 1..115 367 61.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25706-PA 115 GM25706-PA 1..115 1..115 580 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14712-PA 115 GD14712-PA 1..115 1..115 582 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13166-PA 99 GJ13166-PA 32..99 44..115 160 48.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17745-PA 119 GK17745-PA 1..94 1..96 264 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19917-PA 108 GE19917-PA 1..108 1..115 443 74.1 Plus