BDGP Sequence Production Resources |
Search the DGRC for IP06110
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 61 |
Well: | 10 |
Vector: | pOT2 |
Associated Gene/Transcript | edin-RA |
Protein status: | IP06110.pep: gold |
Preliminary Size: | 348 |
Sequenced Size: | 447 |
Gene | Date | Evidence |
---|---|---|
CG32185 | 2005-01-01 | Successful iPCR screen |
CG32185 | 2008-04-29 | Release 5.5 accounting |
CG32185 | 2008-08-15 | Release 5.9 accounting |
CG32185 | 2008-12-18 | 5.12 accounting |
447 bp (447 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023614
> IP06110.complete CCAGCAAAGATGTTCTCCAACAAGTGCGGAATACTGATCCTCGTGTCCTG CTGTCTGGTGACAATAGTGGCCTCCTATCGTCAACCATATCCCGAGGAGT TCCAGACCAGTCCAGAGCAGCTGCTCCAAGTGGCACCCTTGGTACGCCGT GCTCGATCGCCTGAGGGAGGATCCGTGGTCGTAACCGCCAGCAAGGACAA CCAAGTGGGTCGGGAGGCTAGTGTTCAGTACAACCACAATCTGTATAGTA GTGGCGATGGGCGTGGCAGCATCGACGCCTACGCCCAGGCCAGTCGGAAT TTCGACTACAATCGGAACAACTACGAAGGCGGCATTCGGGGCACCTGGCA TTTCTGAGCGGGAACAGAAGTATTAAGTTGGTTACAACTTGATTCATGTG AATAAATACGTGTGTTTACCCAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32185-RA | 421 | CG32185-RA | 1..421 | 1..421 | 2105 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 17484411..17484831 | 1..421 | 2060 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 17494880..17495302 | 1..423 | 2115 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 17487980..17488402 | 1..423 | 2115 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 17484411..17484831 | 1..421 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
edin-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
edin-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
edin-RA | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32185-RA | 1..348 | 10..357 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
edin-RA | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17494880..17495300 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17494880..17495300 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17494880..17495300 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 17487980..17488400 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17487980..17488400 | 1..421 | 100 | Plus |
Translation from 0 to 356
> IP06110.hyp PAKMFSNKCGILILVSCCLVTIVASYRQPYPEEFQTSPEQLLQVAPLVRR ARSPEGGSVVVTASKDNQVGREASVQYNHNLYSSGDGRGSIDAYAQASRN FDYNRNNYEGGIRGTWHF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
edin-PA | 115 | CG32185-PA | 1..115 | 4..118 | 607 | 100 | Plus |
Translation from 9 to 356
> IP06110.pep MFSNKCGILILVSCCLVTIVASYRQPYPEEFQTSPEQLLQVAPLVRRARS PEGGSVVVTASKDNQVGREASVQYNHNLYSSGDGRGSIDAYAQASRNFDY NRNNYEGGIRGTWHF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10536-PA | 116 | GF10536-PA | 1..116 | 1..115 | 395 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13620-PA | 116 | GG13620-PA | 1..116 | 1..115 | 425 | 69.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16191-PA | 109 | GH16191-PA | 1..109 | 1..115 | 266 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
edin-PA | 115 | CG32185-PA | 1..115 | 1..115 | 607 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15586-PA | 109 | GL15586-PA | 1..109 | 1..115 | 364 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16743-PA | 109 | GA16743-PA | 1..109 | 1..115 | 367 | 61.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25706-PA | 115 | GM25706-PA | 1..115 | 1..115 | 580 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14712-PA | 115 | GD14712-PA | 1..115 | 1..115 | 582 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13166-PA | 99 | GJ13166-PA | 32..99 | 44..115 | 160 | 48.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17745-PA | 119 | GK17745-PA | 1..94 | 1..96 | 264 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19917-PA | 108 | GE19917-PA | 1..108 | 1..115 | 443 | 74.1 | Plus |