Clone IP06116 Report

Search the DGRC for IP06116

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:61
Well:16
Vector:pOT2
Associated Gene/TranscriptCG15841-RA
Protein status:IP06116.pep: wuzgold
Preliminary Size:343
Sequenced Size:339

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32952 2005-01-01 Successful iPCR screen
CG6555 2008-04-29 Release 5.5 accounting
CG6555 2008-08-15 Release 5.9 accounting
CG15841 2008-08-15 Release 5.9 accounting
CG6555 2008-12-18 5.12 accounting
CG15841 2008-12-18 5.12 accounting

Clone Sequence Records

IP06116.complete Sequence

339 bp (339 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022489

> IP06116.complete
TCCAAGCGAGTTCCATTTCTTTTCACCATTATCCTGTTTCTGGCTGGACT
GGGTCAGCACACAACTGAAAGTGTACTTCCAGACTGCGTTCTTTATCCAA
GATGTTTGATCACAAAGGATCCGTGTTGCATGTAAAGCATCTATAGAAAT
CAAAGAAGGATCTTGTATATGGAAGTGGAAATGTGGTTCAAAATATCAGC
ACTTCTCAAGGCTGTAACAAAAACTGCACTCTGTTTTTATAAATACAAAT
ATCCACAAATATCTGGTCTTAACATGGCAACATTTCAAGTCTTCCAATAA
ATCATTTTCGTTTTTATTGTGAAAAAAAAAAAAAAAAAA

IP06116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6555-RA 341 CG6555-RA 20..341 1..322 1610 100 Plus
CG15841-RA 341 CG15841-RA 20..341 1..322 1610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11590098..11590418 321..1 1605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11591338..11591659 322..1 1610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11591338..11591659 322..1 1610 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:41:28 has no hits.

IP06116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:42:43 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11590098..11590418 1..321 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:03 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 10..144 1..135 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:01 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 10..144 1..135 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:59:32 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 10..144 1..135 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:06 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 10..144 1..135 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:04:14 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
Acp33A-RA 10..144 1..135 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:17 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG15841-RA 20..340 1..321 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:01 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 20..340 1..321 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:59:32 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG15841-RA 20..340 1..321 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:06 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
CG15841-RA 20..340 1..321 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:04:14 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
Acp33A-RA 20..340 1..321 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:43 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11591339..11591659 1..321 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:43 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11591339..11591659 1..321 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:43 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11591339..11591659 1..321 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:59:32 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11591339..11591659 1..321 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:48 Download gff for IP06116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11591339..11591659 1..321 100   Minus

IP06116.hyp Sequence

Translation from 0 to 134

> IP06116.hyp
SKRVPFLFTIILFLAGLGQHTTESVLPDCVLYPRCLITKDPCCM*

IP06116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Acp33A-PA 47 CG6555-PA 4..47 1..44 240 100 Plus

IP06116.pep Sequence

Translation from 168 to 299

> IP06116.pep
MEVEMWFKISALLKAVTKTALCFYKYKYPQISGLNMATFQVFQ*
Sequence IP06116.pep has no blast hits.