BDGP Sequence Production Resources |
Search the DGRC for IP06141
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 61 |
Well: | 41 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4537-RB |
Protein status: | IP06141.pep: gold |
Preliminary Size: | 404 |
Sequenced Size: | 412 |
Gene | Date | Evidence |
---|---|---|
CG4537 | 2005-01-01 | Successful iPCR screen |
CG4537 | 2008-04-29 | Release 5.5 accounting |
CG4537 | 2008-08-15 | Release 5.9 accounting |
CG4537 | 2008-12-18 | 5.12 accounting |
412 bp (412 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022494
> IP06141.complete AAAACAAATTGAATTGATAACAAAAATGGTTTGCGAGAAGTGCGAGGCCA AGCTCTCCAAAGTTTCAGCGCCCAATCCCTGGCGAACGAGCACAGCTCCT GCGGGAGGACGTAAAATCAACGAGAACAAGGCTTTATCCTCGGCCCGCGA GCGATACAATCCCATAGGGACTGCTTTACCACCTTGCCGAATCTGCCGAC AGAAAGTGCACCAGATGGGTTCGCACTATTGCCAGGCGTGCGCCTACAAA AAGGCCATATGCGCCATGTGCGGCAAGAAGATCATGAACACCAAGAACTA CAAGCAGAGCTCAACGTGATGCAGTTTATCAAAGGATGCACTTAAGACTA AACTAACCATAGACAACAGAATAATTATAACCTATAGTACAAAAAAAAAA AAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 9889808..9889996 | 1..189 | 100 | -> | Plus |
chr2L | 9890056..9890256 | 190..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..294 | 26..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..294 | 26..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..294 | 26..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..294 | 26..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..294 | 26..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4537-RB | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9890885..9891073 | 1..189 | 100 | -> | Plus |
2L | 9891133..9891333 | 190..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9890885..9891073 | 1..189 | 100 | -> | Plus |
2L | 9891133..9891333 | 190..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9890885..9891073 | 1..189 | 100 | -> | Plus |
2L | 9891133..9891333 | 190..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 9890885..9891073 | 1..189 | 100 | -> | Plus |
arm_2L | 9891133..9891333 | 190..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9890885..9891073 | 1..189 | 100 | -> | Plus |
2L | 9891133..9891333 | 190..390 | 100 | Plus |
Translation from 0 to 318
> IP06141.hyp KQIELITKMVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARE RYNPIGTALPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNY KQSST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4537-PB | 97 | CG4537-PB | 1..97 | 9..105 | 530 | 100 | Plus |
Translation from 1 to 318
> IP06141.pep KQIELITKMVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARE RYNPIGTALPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNY KQSST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14674-PA | 97 | GF14674-PA | 1..97 | 9..105 | 479 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10060-PA | 116 | GG10060-PA | 12..116 | 1..105 | 543 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11298-PA | 97 | GH11298-PA | 1..97 | 9..105 | 463 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4537-PB | 97 | CG4537-PB | 1..97 | 9..105 | 530 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17717-PA | 97 | GI17717-PA | 1..97 | 9..105 | 453 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18938-PA | 97 | GL18938-PA | 1..97 | 9..105 | 484 | 92.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18241-PA | 97 | GA18241-PA | 1..97 | 9..105 | 484 | 92.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17722-PA | 97 | GM17722-PA | 1..97 | 9..105 | 504 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23633-PA | 116 | GD23633-PA | 12..116 | 1..105 | 549 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17546-PA | 97 | GJ17546-PA | 1..97 | 9..105 | 454 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23814-PA | 97 | GK23814-PA | 1..97 | 9..105 | 466 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18874-PA | 119 | GE18874-PA | 15..119 | 1..105 | 545 | 99 | Plus |