Clone IP06141 Report

Search the DGRC for IP06141

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:61
Well:41
Vector:pOT2
Associated Gene/TranscriptCG4537-RB
Protein status:IP06141.pep: gold
Preliminary Size:404
Sequenced Size:412

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4537 2005-01-01 Successful iPCR screen
CG4537 2008-04-29 Release 5.5 accounting
CG4537 2008-08-15 Release 5.9 accounting
CG4537 2008-12-18 5.12 accounting

Clone Sequence Records

IP06141.complete Sequence

412 bp (412 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022494

> IP06141.complete
AAAACAAATTGAATTGATAACAAAAATGGTTTGCGAGAAGTGCGAGGCCA
AGCTCTCCAAAGTTTCAGCGCCCAATCCCTGGCGAACGAGCACAGCTCCT
GCGGGAGGACGTAAAATCAACGAGAACAAGGCTTTATCCTCGGCCCGCGA
GCGATACAATCCCATAGGGACTGCTTTACCACCTTGCCGAATCTGCCGAC
AGAAAGTGCACCAGATGGGTTCGCACTATTGCCAGGCGTGCGCCTACAAA
AAGGCCATATGCGCCATGTGCGGCAAGAAGATCATGAACACCAAGAACTA
CAAGCAGAGCTCAACGTGATGCAGTTTATCAAAGGATGCACTTAAGACTA
AACTAACCATAGACAACAGAATAATTATAACCTATAGTACAAAAAAAAAA
AAAAAAAAAAAA

IP06141.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-RB 433 CG4537-RB 1..396 1..396 1965 99.7 Plus
CG5924-RA 2058 CG5924-RA 1940..2058 396..278 580 99.1 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9890055..9890256 189..390 980 99 Plus
chr2L 23010047 chr2L 9889808..9889996 1..189 945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9891132..9891339 189..396 1025 99.5 Plus
2L 23513712 2L 9890885..9891073 1..189 945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9891132..9891339 189..396 1025 99.5 Plus
2L 23513712 2L 9890885..9891073 1..189 945 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:30:07 has no hits.

IP06141.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:31:29 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9889808..9889996 1..189 100 -> Plus
chr2L 9890056..9890256 190..390 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:07 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..294 26..319 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:33 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..294 26..319 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:54 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..294 26..319 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:10 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..294 26..319 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:09 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..294 26..319 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:15 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:33 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:54 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:10 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:09 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 1..390 1..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:29 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890885..9891073 1..189 100 -> Plus
2L 9891133..9891333 190..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:29 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890885..9891073 1..189 100 -> Plus
2L 9891133..9891333 190..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:29 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890885..9891073 1..189 100 -> Plus
2L 9891133..9891333 190..390 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:54 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9890885..9891073 1..189 100 -> Plus
arm_2L 9891133..9891333 190..390 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:50 Download gff for IP06141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890885..9891073 1..189 100 -> Plus
2L 9891133..9891333 190..390 100   Plus

IP06141.hyp Sequence

Translation from 0 to 318

> IP06141.hyp
KQIELITKMVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARE
RYNPIGTALPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNY
KQSST*

IP06141.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-PB 97 CG4537-PB 1..97 9..105 530 100 Plus

IP06141.pep Sequence

Translation from 1 to 318

> IP06141.pep
KQIELITKMVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARE
RYNPIGTALPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNY
KQSST*

IP06141.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14674-PA 97 GF14674-PA 1..97 9..105 479 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10060-PA 116 GG10060-PA 12..116 1..105 543 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11298-PA 97 GH11298-PA 1..97 9..105 463 87.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-PB 97 CG4537-PB 1..97 9..105 530 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17717-PA 97 GI17717-PA 1..97 9..105 453 84.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18938-PA 97 GL18938-PA 1..97 9..105 484 92.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18241-PA 97 GA18241-PA 1..97 9..105 484 92.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17722-PA 97 GM17722-PA 1..97 9..105 504 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23633-PA 116 GD23633-PA 12..116 1..105 549 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17546-PA 97 GJ17546-PA 1..97 9..105 454 84.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23814-PA 97 GK23814-PA 1..97 9..105 466 89.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18874-PA 119 GE18874-PA 15..119 1..105 545 99 Plus