Clone IP06146 Report

Search the DGRC for IP06146

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:61
Well:46
Vector:pOT2
Associated Gene/TranscriptCG42827-RC
Protein status:IP06146.pep: gold
Preliminary Size:453
Sequenced Size:578

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6784 2005-01-01 Successful iPCR screen
CG6784 2008-04-29 Release 5.5 accounting
CG6784 2008-08-15 Release 5.9 accounting
CG6784 2008-12-18 5.12 accounting

Clone Sequence Records

IP06146.complete Sequence

578 bp (578 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022498

> IP06146.complete
CCATACTGTGAAAACAATTCATCAAGTGACTTAATGATAGCACACTGAGA
AAAACGTTTAAGTTGTATTAAATGAACCTTTGCACACCATTGGCTATATA
AAAAGCATTTGATCAGATTTTTGTTCATATTCCAAGAATCAAAATGCGTT
TGACAATCTTATGTATTTTTTGCCTGGCAACTGTGATCCTGGCTATCGAC
ATGGACTCGGATTCACTACAGGAACAGTACGAAAGGGAGCAGTACAATAT
TCGCAAAAAAATTTGCCTTCAAAGTTCGGAATACGGAAAGTGCAAAGGTC
GTCGGAAACTTTGGTTCTACAACCCCAAGAAATCCAAGTGTCAAGTTTTT
ATCTACTCGAATTGTGGTGGCAATGGCAACCTTTTCTATACCAAGGAAAG
TTGCGTGGAATTTTGTGGCAAATACGACTGGAAGAAGGTGCGAAAGACAG
GACTTCGACGTTCAGCTGATTATAGAAGAAAAGATGGGAATTAATTGAAT
ATATATACTTGAATTTAACAATTAAATATACATTGTTTAAAGGAAATTAC
TAGTTCACAAAAAAAAAAAAAAAAAAAA

IP06146.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6784-RB 558 CG6784-RB 1..558 1..558 2790 100 Plus
CG6784-RA 653 CG6784-RA 1..459 1..459 2295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19196675..19196974 259..558 1395 97.7 Plus
chr3R 27901430 chr3R 19196431..19196608 81..258 860 98.9 Plus
chr3R 27901430 chr3R 19196298..19196377 1..80 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:47:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23373301..23373603 259..561 1515 100 Plus
3R 32079331 3R 23373057..23373234 81..258 890 100 Plus
3R 32079331 3R 23372924..23373003 1..80 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23114132..23114434 259..561 1515 100 Plus
3R 31820162 3R 23113888..23114065 81..258 890 100 Plus
3R 31820162 3R 23113755..23113834 1..80 400 100 Plus
Blast to na_te.dros performed 2019-03-15 21:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 22..55 500..533 107 79.4 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 6425..6458 500..533 107 79.4 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 23..56 500..533 107 79.4 Plus
Stalker4 7359 Stalker4 STALKER4 7359bp 5813..5860 124..76 107 71.4 Minus
Stalker 7256 Stalker STALKER 7256bp 5707..5754 124..76 107 71.4 Minus

IP06146.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:52:07 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19196431..19196608 81..258 98 -> Plus
chr3R 19196298..19196377 1..80 100 -> Plus
chr3R 19196675..19196974 259..558 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:09 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG6784-RB 1..351 144..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:04 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RD 1..351 144..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:00:41 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 1..351 144..494 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:42 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG6784-RB 1..351 144..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:04:54 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 1..351 144..494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:21 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG6784-RB 1..558 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:03 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 1..558 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:00:41 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 1..558 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:42 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG6784-RB 1..558 1..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:04:54 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 1..558 1..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:07 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23372924..23373003 1..80 100 -> Plus
3R 23373057..23373234 81..258 100 -> Plus
3R 23373301..23373600 259..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:07 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23372924..23373003 1..80 100 -> Plus
3R 23373057..23373234 81..258 100 -> Plus
3R 23373301..23373600 259..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:07 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23372924..23373003 1..80 100 -> Plus
3R 23373057..23373234 81..258 100 -> Plus
3R 23373301..23373600 259..558 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:00:41 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19198646..19198725 1..80 100 -> Plus
arm_3R 19198779..19198956 81..258 100 -> Plus
arm_3R 19199023..19199322 259..558 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:40 Download gff for IP06146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23114132..23114431 259..558 100   Plus
3R 23113755..23113834 1..80 100 -> Plus
3R 23113888..23114065 81..258 100 -> Plus

IP06146.pep Sequence

Translation from 143 to 493

> IP06146.pep
MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC
KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR
KTGLRRSADYRRKDGN*

IP06146.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16246-PA 169 GF16246-PA 8..95 11..98 237 47.7 Plus
Dana\GF16246-PA 169 GF16246-PA 99..155 36..91 146 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11203-PA 169 GG11203-PA 1..103 1..103 475 84.5 Plus
Dere\GG11203-PA 169 GG11203-PA 104..160 37..93 136 43.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18720-PA 3177 GH18720-PA 2458..2513 39..94 146 44.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42827-PD 116 CG42827-PD 1..116 1..116 636 100 Plus
CG42827-PC 116 CG6784-PB 1..116 1..116 636 100 Plus
CG42828-PB 89 CG42828-PB 24..78 37..91 166 49.1 Plus
Ppn-PF 2776 CG33103-PF 2193..2247 40..94 148 40 Plus
Ppn-PG 2841 CG33103-PG 2136..2190 40..94 148 40 Plus
Ppn-PE 2898 CG33103-PE 2193..2247 40..94 148 40 Plus
CG2816-PB 84 CG2816-PB 27..81 37..91 134 47.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22048-PA 82 GI22048-PA 15..76 40..101 175 54.8 Plus
Dmoj\GI18884-PA 85 GI18884-PA 25..77 41..93 152 47.2 Plus
Dmoj\GI22868-PA 2991 GI22868-PA 2274..2329 39..94 147 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13634-PA 104 GL13634-PA 6..98 6..95 237 49.5 Plus
Dper\GL13730-PA 93 GL13730-PA 23..87 31..95 153 44.6 Plus
Dper\GL23094-PA 2914 GL23094-PA 2204..2258 40..94 144 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25574-PA 104 GA25574-PA 6..98 6..95 237 49.5 Plus
Dpse\GA30093-PA 120 GA30093-PA 4..100 1..95 205 41.2 Plus
Dpse\GA30092-PA 114 GA30092-PA 4..102 1..97 179 38.8 Plus
Dpse\GA30104-PA 86 GA30104-PA 4..85 1..91 176 42.9 Plus
Dpse\GA27009-PA 93 GA27009-PA 23..87 31..95 153 44.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26503-PA 166 GM26503-PA 1..104 1..104 518 92.3 Plus
Dsec\GM26503-PA 166 GM26503-PA 99..156 36..92 136 46.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21015-PA 166 GD21015-PA 1..104 1..104 512 90.4 Plus
Dsim\GD21015-PA 166 GD21015-PA 99..156 36..92 135 46.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21919-PA 107 GJ21919-PA 40..101 30..91 140 38.7 Plus
Dvir\GJ14166-PA 3023 GJ14166-PA 2305..2360 39..94 140 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14112-PA 179 GK14112-PA 9..100 5..98 217 40.4 Plus
Dwil\GK14112-PA 179 GK14112-PA 107..161 39..93 154 45.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10370-PA 116 GE10370-PA 1..116 1..116 452 72.4 Plus
Dyak\GE10512-PA 2898 GE10512-PA 2193..2247 40..94 141 40 Plus

IP06146.hyp Sequence

Translation from 143 to 493

> IP06146.hyp
MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC
KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR
KTGLRRSADYRRKDGN*

IP06146.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42827-PD 116 CG42827-PD 1..116 1..116 636 100 Plus
CG42827-PC 116 CG6784-PB 1..116 1..116 636 100 Plus
CG42828-PB 89 CG42828-PB 24..78 37..91 166 49.1 Plus
Ppn-PF 2776 CG33103-PF 2193..2247 40..94 148 40 Plus
Ppn-PG 2841 CG33103-PG 2136..2190 40..94 148 40 Plus