BDGP Sequence Production Resources |
Search the DGRC for IP06146
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 61 |
Well: | 46 |
Vector: | pOT2 |
Associated Gene/Transcript | CG42827-RC |
Protein status: | IP06146.pep: gold |
Preliminary Size: | 453 |
Sequenced Size: | 578 |
Gene | Date | Evidence |
---|---|---|
CG6784 | 2005-01-01 | Successful iPCR screen |
CG6784 | 2008-04-29 | Release 5.5 accounting |
CG6784 | 2008-08-15 | Release 5.9 accounting |
CG6784 | 2008-12-18 | 5.12 accounting |
578 bp (578 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022498
> IP06146.complete CCATACTGTGAAAACAATTCATCAAGTGACTTAATGATAGCACACTGAGA AAAACGTTTAAGTTGTATTAAATGAACCTTTGCACACCATTGGCTATATA AAAAGCATTTGATCAGATTTTTGTTCATATTCCAAGAATCAAAATGCGTT TGACAATCTTATGTATTTTTTGCCTGGCAACTGTGATCCTGGCTATCGAC ATGGACTCGGATTCACTACAGGAACAGTACGAAAGGGAGCAGTACAATAT TCGCAAAAAAATTTGCCTTCAAAGTTCGGAATACGGAAAGTGCAAAGGTC GTCGGAAACTTTGGTTCTACAACCCCAAGAAATCCAAGTGTCAAGTTTTT ATCTACTCGAATTGTGGTGGCAATGGCAACCTTTTCTATACCAAGGAAAG TTGCGTGGAATTTTGTGGCAAATACGACTGGAAGAAGGTGCGAAAGACAG GACTTCGACGTTCAGCTGATTATAGAAGAAAAGATGGGAATTAATTGAAT ATATATACTTGAATTTAACAATTAAATATACATTGTTTAAAGGAAATTAC TAGTTCACAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 19196675..19196974 | 259..558 | 1395 | 97.7 | Plus |
chr3R | 27901430 | chr3R | 19196431..19196608 | 81..258 | 860 | 98.9 | Plus |
chr3R | 27901430 | chr3R | 19196298..19196377 | 1..80 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Uvir | 6564 | Dvir\Uvir VIRUVIR 6564bp | 22..55 | 500..533 | 107 | 79.4 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 6425..6458 | 500..533 | 107 | 79.4 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 23..56 | 500..533 | 107 | 79.4 | Plus |
Stalker4 | 7359 | Stalker4 STALKER4 7359bp | 5813..5860 | 124..76 | 107 | 71.4 | Minus |
Stalker | 7256 | Stalker STALKER 7256bp | 5707..5754 | 124..76 | 107 | 71.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19196431..19196608 | 81..258 | 98 | -> | Plus |
chr3R | 19196298..19196377 | 1..80 | 100 | -> | Plus |
chr3R | 19196675..19196974 | 259..558 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6784-RB | 1..351 | 144..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RD | 1..351 | 144..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RC | 1..351 | 144..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6784-RB | 1..351 | 144..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RC | 1..351 | 144..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6784-RB | 1..558 | 1..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RC | 1..558 | 1..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RC | 1..558 | 1..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6784-RB | 1..558 | 1..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42827-RC | 1..558 | 1..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23372924..23373003 | 1..80 | 100 | -> | Plus |
3R | 23373057..23373234 | 81..258 | 100 | -> | Plus |
3R | 23373301..23373600 | 259..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23372924..23373003 | 1..80 | 100 | -> | Plus |
3R | 23373057..23373234 | 81..258 | 100 | -> | Plus |
3R | 23373301..23373600 | 259..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23372924..23373003 | 1..80 | 100 | -> | Plus |
3R | 23373057..23373234 | 81..258 | 100 | -> | Plus |
3R | 23373301..23373600 | 259..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19198646..19198725 | 1..80 | 100 | -> | Plus |
arm_3R | 19198779..19198956 | 81..258 | 100 | -> | Plus |
arm_3R | 19199023..19199322 | 259..558 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23114132..23114431 | 259..558 | 100 | Plus | |
3R | 23113755..23113834 | 1..80 | 100 | -> | Plus |
3R | 23113888..23114065 | 81..258 | 100 | -> | Plus |
Translation from 143 to 493
> IP06146.pep MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR KTGLRRSADYRRKDGN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16246-PA | 169 | GF16246-PA | 8..95 | 11..98 | 237 | 47.7 | Plus |
Dana\GF16246-PA | 169 | GF16246-PA | 99..155 | 36..91 | 146 | 47.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11203-PA | 169 | GG11203-PA | 1..103 | 1..103 | 475 | 84.5 | Plus |
Dere\GG11203-PA | 169 | GG11203-PA | 104..160 | 37..93 | 136 | 43.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18720-PA | 3177 | GH18720-PA | 2458..2513 | 39..94 | 146 | 44.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42827-PD | 116 | CG42827-PD | 1..116 | 1..116 | 636 | 100 | Plus |
CG42827-PC | 116 | CG6784-PB | 1..116 | 1..116 | 636 | 100 | Plus |
CG42828-PB | 89 | CG42828-PB | 24..78 | 37..91 | 166 | 49.1 | Plus |
Ppn-PF | 2776 | CG33103-PF | 2193..2247 | 40..94 | 148 | 40 | Plus |
Ppn-PG | 2841 | CG33103-PG | 2136..2190 | 40..94 | 148 | 40 | Plus |
Ppn-PE | 2898 | CG33103-PE | 2193..2247 | 40..94 | 148 | 40 | Plus |
CG2816-PB | 84 | CG2816-PB | 27..81 | 37..91 | 134 | 47.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22048-PA | 82 | GI22048-PA | 15..76 | 40..101 | 175 | 54.8 | Plus |
Dmoj\GI18884-PA | 85 | GI18884-PA | 25..77 | 41..93 | 152 | 47.2 | Plus |
Dmoj\GI22868-PA | 2991 | GI22868-PA | 2274..2329 | 39..94 | 147 | 44.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13634-PA | 104 | GL13634-PA | 6..98 | 6..95 | 237 | 49.5 | Plus |
Dper\GL13730-PA | 93 | GL13730-PA | 23..87 | 31..95 | 153 | 44.6 | Plus |
Dper\GL23094-PA | 2914 | GL23094-PA | 2204..2258 | 40..94 | 144 | 43.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25574-PA | 104 | GA25574-PA | 6..98 | 6..95 | 237 | 49.5 | Plus |
Dpse\GA30093-PA | 120 | GA30093-PA | 4..100 | 1..95 | 205 | 41.2 | Plus |
Dpse\GA30092-PA | 114 | GA30092-PA | 4..102 | 1..97 | 179 | 38.8 | Plus |
Dpse\GA30104-PA | 86 | GA30104-PA | 4..85 | 1..91 | 176 | 42.9 | Plus |
Dpse\GA27009-PA | 93 | GA27009-PA | 23..87 | 31..95 | 153 | 44.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26503-PA | 166 | GM26503-PA | 1..104 | 1..104 | 518 | 92.3 | Plus |
Dsec\GM26503-PA | 166 | GM26503-PA | 99..156 | 36..92 | 136 | 46.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21015-PA | 166 | GD21015-PA | 1..104 | 1..104 | 512 | 90.4 | Plus |
Dsim\GD21015-PA | 166 | GD21015-PA | 99..156 | 36..92 | 135 | 46.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21919-PA | 107 | GJ21919-PA | 40..101 | 30..91 | 140 | 38.7 | Plus |
Dvir\GJ14166-PA | 3023 | GJ14166-PA | 2305..2360 | 39..94 | 140 | 42.9 | Plus |
Translation from 143 to 493
> IP06146.hyp MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR KTGLRRSADYRRKDGN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42827-PD | 116 | CG42827-PD | 1..116 | 1..116 | 636 | 100 | Plus |
CG42827-PC | 116 | CG6784-PB | 1..116 | 1..116 | 636 | 100 | Plus |
CG42828-PB | 89 | CG42828-PB | 24..78 | 37..91 | 166 | 49.1 | Plus |
Ppn-PF | 2776 | CG33103-PF | 2193..2247 | 40..94 | 148 | 40 | Plus |
Ppn-PG | 2841 | CG33103-PG | 2136..2190 | 40..94 | 148 | 40 | Plus |