Clone IP06248 Report

Search the DGRC for IP06248

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:62
Well:48
Vector:pOT2
Associated Gene/TranscriptCG7423-RA
Protein status:IP06248.pep: gold
Preliminary Size:375
Sequenced Size:614

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7423 2005-01-01 Successful iPCR screen
CG7423 2008-04-29 Release 5.5 accounting
CG7423 2008-08-15 Release 5.9 accounting
CG7423 2008-12-18 5.12 accounting

Clone Sequence Records

IP06248.complete Sequence

614 bp (614 high quality bases) assembled on 2005-12-20

GenBank Submission: BT024380

> IP06248.complete
AAAAACTGAGTCAAACGGATCACGATGGGCGATGGACACAAAATCGAGGA
CATCATCTGGACAATCAAGAACGGCGTGTACGACGAGGTGGAGCGAATTT
TCCTAGCCGGATCGCTTAATGTGAACGATCAGATGGGCGTCCGGTTCCCC
TTGCACTACGCCGCCGACTTTGGCCAGCTGAAGCTGCTGGAGTTCTTTGT
GCGGATCGGCGCGGAGGTGGACAGGAAGGACAAGTACGGCATCACACCGC
TCCTGGCGGCCATATGGGAGGGGCATACACGCTGCGTCGAGTTCCTGCTC
CGGATGGGAGCCAGCCGCACGGAGCGCACGCCCGAGGGGCAGAGCTACGC
GGAGGCCGCCGAGCAGGAGGACATTAGACGGCTCCTGGCGCGGGACTGAG
GTCCTTGGGGATGTCCTCGTAACTCCTGACAGGGCATCATATATGGGAGA
TCCACCTATTGTACATTTTGCAAATTTTTAGTGTAACCTTTTGATAGGTT
CATTTGCTAGCTGACTGATTGTAAGCGATGCATCAGCAGCTCTTACAATC
TTGAAAACGAATTTTCTTGGAATTACAAGGTGGATTTATATCGAGAAAAA
AAAAAAAAAAAAAA

IP06248.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7423-RA 595 CG7423-RA 1..595 1..595 2975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18971519..18972113 595..1 2975 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19082607..19083203 597..1 2985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19090705..19091301 597..1 2985 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:45:39 has no hits.

IP06248.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:46:44 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18971519..18972113 1..595 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:12 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:58 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:53:12 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:51 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:07 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:53:18 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:58 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:53:12 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:52 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 1..375 25..399 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:07 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
CG7423-RA 88..682 1..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:46:44 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
X 19082609..19083203 1..595 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:46:44 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
X 19082609..19083203 1..595 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:46:44 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
X 19082609..19083203 1..595 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:53:12 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18976642..18977236 1..595 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:50 Download gff for IP06248.complete
Subject Subject Range Query Range Percent Splice Strand
X 19090707..19091301 1..595 100   Minus

IP06248.hyp Sequence

Translation from 24 to 398

> IP06248.hyp
MGDGHKIEDIIWTIKNGVYDEVERIFLAGSLNVNDQMGVRFPLHYAADFG
QLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTE
RTPEGQSYAEAAEQEDIRRLLARD*

IP06248.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7423-PA 124 CG7423-PA 1..124 1..124 646 100 Plus
CG31715-PA 121 CG31715-PA 7..121 8..122 397 61.7 Plus
CG31715-PB 119 CG31715-PB 7..119 8..122 374 60 Plus

IP06248.pep Sequence

Translation from 24 to 398

> IP06248.pep
MGDGHKIEDIIWTIKNGVYDEVERIFLAGSLNVNDQMGVRFPLHYAADFG
QLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTE
RTPEGQSYAEAAEQEDIRRLLARD*

IP06248.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16011-PA 146 GF16011-PA 2..145 4..123 486 68.1 Plus
Dana\GF15769-PA 121 GF15769-PA 7..121 8..122 412 62.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10110-PA 121 GG10110-PA 7..121 8..122 407 61.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22750-PA 125 GH22750-PA 6..119 8..121 393 62.3 Plus
Dgri\GH13540-PA 123 GH13540-PA 7..121 8..122 393 57.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7423-PA 124 CG7423-PA 1..124 1..124 646 100 Plus
CG31715-PA 121 CG31715-PA 7..121 8..122 397 61.7 Plus
CG31715-PB 119 CG31715-PB 7..119 8..122 374 60 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10598-PA 121 GI10598-PA 7..120 8..121 398 60.5 Plus
Dmoj\GI21091-PA 125 GI21091-PA 2..119 4..121 370 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14660-PA 127 GL14660-PA 1..121 1..121 438 63.6 Plus
Dper\GL18996-PA 117 GL18996-PA 3..116 8..121 392 59.6 Plus
Dper\GL22305-PA 1187 GL22305-PA 695..787 28..121 140 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20339-PA 336 GA20339-PA 1..121 1..121 436 62.8 Plus
Dpse\GA22482-PA 117 GA22482-PA 3..116 8..121 392 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22773-PA 124 GM22773-PA 1..124 1..124 587 91.1 Plus
Dsec\GM18191-PA 121 GM18191-PA 7..121 8..122 396 59.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15607-PA 88 GD15607-PA 1..88 37..124 409 89.8 Plus
Dsim\GD23680-PA 121 GD23680-PA 7..121 8..122 396 59.1 Plus
Dsim\GD15606-PA 50 GD15606-PA 20..50 5..35 148 90.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17533-PA 123 GJ17533-PA 7..122 8..123 385 56 Plus
Dvir\GJ20938-PA 125 GJ20938-PA 6..119 8..121 382 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25099-PA 125 GK25099-PA 2..122 3..121 437 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18925-PA 121 GE18925-PA 7..121 8..122 410 62.6 Plus