Clone IP06311 Report

Search the DGRC for IP06311

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:63
Well:11
Vector:pOT2
Associated Gene/TranscriptCG32202-RA
Protein status:IP06311.pep: gold
Preliminary Size:402
Sequenced Size:620

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32202 2005-01-01 Successful iPCR screen
CG32202 2008-04-29 Release 5.5 accounting
CG32202 2008-08-15 Release 5.9 accounting
CG32202 2008-12-18 5.12 accounting

Clone Sequence Records

IP06311.complete Sequence

620 bp (620 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022502

> IP06311.complete
CCATCTGGCCACACTGAGCCATGGCGTAAATAAAAACATTTCTAAATATT
GAACTATAACCAATATCTGTATAAAATGTTGCTAAATAAGAAAGAACTCA
TGTACAAACAGCTGGTGGAAAAACTGTATGACAGGTGCCAAAGGATTCAG
GCGGAAAATGAGCGATGTGTGATGAGAGTAAATGGGATCAAAAAGATAGT
AAGAAGGCGCAATCATGACGTGGAGCTTCTAAAACGGCGACTAGATAAGC
ACGGAGACGACTGGCGATCCGTTCCCATGGAGGCTCCACATCCCAAAGGG
AAAACCGAGCAGAAGCGTCGAGGACCGAAGCCCAAAAACAAGCAGGCGGC
GGATGAAACAGGAGCACCCGGGTCTGAGCCTGGACCCAATACTCCAGCTG
CCCGGAAACCCCGAAAGCAAAAAGCCAAACAGGCACCCATCAATCCCAAT
CCAGTCATTGCACCACCGCATCAACAACCTCAACCTCCACTGTTGACCTG
AGTCATAGCGATTGCTTGGCGTGTTCTAGTTTTAAGATAAAGGGCTTGTA
TACTTTTAAATATAATATTAAGACAAATAAAAGCTAAGACCAGAAATGAA
AAAAAAAAAAAAAAAAAAAA

IP06311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32202-RA 660 CG32202-RA 17..616 1..600 3000 100 Plus
CG32202.a 625 CG32202.a 189..614 175..600 2130 100 Plus
CG32202.a 625 CG32202.a 1..176 1..176 880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18672117..18672540 175..598 2105 99.8 Plus
chr3L 24539361 chr3L 18671882..18672057 1..176 865 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18682437..18682862 175..600 2130 100 Plus
3L 28110227 3L 18682202..18682377 1..176 880 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18675537..18675962 175..600 2130 100 Plus
3L 28103327 3L 18675302..18675477 1..176 880 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:41:58 has no hits.

IP06311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:42:57 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18671882..18672057 1..176 99 -> Plus
chr3L 18672119..18672540 177..598 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:14 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..426 76..501 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:46:58 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..426 76..501 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:11 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..426 76..501 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:28:38 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..426 76..501 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:04:45 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..426 76..501 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:20:25 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..561 33..593 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:46:58 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..561 33..593 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:11 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 19..616 1..598 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:28:38 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 1..561 33..593 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:04:45 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
CG32202-RA 19..616 1..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:57 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18682202..18682377 1..176 100 -> Plus
3L 18682439..18682860 177..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:57 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18682202..18682377 1..176 100 -> Plus
3L 18682439..18682860 177..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:42:57 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18682202..18682377 1..176 100 -> Plus
3L 18682439..18682860 177..598 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:11 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18675302..18675477 1..176 100 -> Plus
arm_3L 18675539..18675960 177..598 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:11 Download gff for IP06311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18675539..18675960 177..598 100   Plus
3L 18675302..18675477 1..176 100 -> Plus

IP06311.pep Sequence

Translation from 75 to 500

> IP06311.pep
MLLNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVE
LLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGS
EPGPNTPAARKPRKQKAKQAPINPNPVIAPPHQQPQPPLLT*

IP06311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23636-PA 134 GF23636-PA 1..130 1..136 493 70.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13672-PA 139 GG13672-PA 1..139 1..141 655 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14370-PA 131 GH14370-PA 3..126 2..125 337 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32202-PA 141 CG32202-PA 1..141 1..141 758 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13966-PA 130 GI13966-PA 1..113 1..118 353 59.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22890-PA 132 GL22890-PA 1..131 1..139 440 66.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16754-PA 132 GA16754-PA 1..131 1..139 435 66.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14987-PA 141 GM14987-PA 1..129 1..129 645 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14764-PA 141 GD14764-PA 1..141 1..141 648 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11227-PA 132 GJ11227-PA 1..120 1..129 347 59.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12066-PA 156 GK12066-PA 1..140 1..122 379 55 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19969-PA 141 GE19969-PA 1..141 1..141 665 92.2 Plus

IP06311.hyp Sequence

Translation from 75 to 500

> IP06311.hyp
MLLNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVE
LLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGS
EPGPNTPAARKPRKQKAKQAPINPNPVIAPPHQQPQPPLLT*

IP06311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32202-PA 141 CG32202-PA 1..141 1..141 758 100 Plus