BDGP Sequence Production Resources |
Search the DGRC for IP06311
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 63 |
Well: | 11 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32202-RA |
Protein status: | IP06311.pep: gold |
Preliminary Size: | 402 |
Sequenced Size: | 620 |
Gene | Date | Evidence |
---|---|---|
CG32202 | 2005-01-01 | Successful iPCR screen |
CG32202 | 2008-04-29 | Release 5.5 accounting |
CG32202 | 2008-08-15 | Release 5.9 accounting |
CG32202 | 2008-12-18 | 5.12 accounting |
620 bp (620 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022502
> IP06311.complete CCATCTGGCCACACTGAGCCATGGCGTAAATAAAAACATTTCTAAATATT GAACTATAACCAATATCTGTATAAAATGTTGCTAAATAAGAAAGAACTCA TGTACAAACAGCTGGTGGAAAAACTGTATGACAGGTGCCAAAGGATTCAG GCGGAAAATGAGCGATGTGTGATGAGAGTAAATGGGATCAAAAAGATAGT AAGAAGGCGCAATCATGACGTGGAGCTTCTAAAACGGCGACTAGATAAGC ACGGAGACGACTGGCGATCCGTTCCCATGGAGGCTCCACATCCCAAAGGG AAAACCGAGCAGAAGCGTCGAGGACCGAAGCCCAAAAACAAGCAGGCGGC GGATGAAACAGGAGCACCCGGGTCTGAGCCTGGACCCAATACTCCAGCTG CCCGGAAACCCCGAAAGCAAAAAGCCAAACAGGCACCCATCAATCCCAAT CCAGTCATTGCACCACCGCATCAACAACCTCAACCTCCACTGTTGACCTG AGTCATAGCGATTGCTTGGCGTGTTCTAGTTTTAAGATAAAGGGCTTGTA TACTTTTAAATATAATATTAAGACAAATAAAAGCTAAGACCAGAAATGAA AAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18671882..18672057 | 1..176 | 99 | -> | Plus |
chr3L | 18672119..18672540 | 177..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..426 | 76..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..426 | 76..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..426 | 76..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..426 | 76..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..426 | 76..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..561 | 33..593 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..561 | 33..593 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 19..616 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 1..561 | 33..593 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32202-RA | 19..616 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18682202..18682377 | 1..176 | 100 | -> | Plus |
3L | 18682439..18682860 | 177..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18682202..18682377 | 1..176 | 100 | -> | Plus |
3L | 18682439..18682860 | 177..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18682202..18682377 | 1..176 | 100 | -> | Plus |
3L | 18682439..18682860 | 177..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18675302..18675477 | 1..176 | 100 | -> | Plus |
arm_3L | 18675539..18675960 | 177..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18675539..18675960 | 177..598 | 100 | Plus | |
3L | 18675302..18675477 | 1..176 | 100 | -> | Plus |
Translation from 75 to 500
> IP06311.pep MLLNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVE LLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGS EPGPNTPAARKPRKQKAKQAPINPNPVIAPPHQQPQPPLLT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23636-PA | 134 | GF23636-PA | 1..130 | 1..136 | 493 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13672-PA | 139 | GG13672-PA | 1..139 | 1..141 | 655 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14370-PA | 131 | GH14370-PA | 3..126 | 2..125 | 337 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32202-PA | 141 | CG32202-PA | 1..141 | 1..141 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13966-PA | 130 | GI13966-PA | 1..113 | 1..118 | 353 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22890-PA | 132 | GL22890-PA | 1..131 | 1..139 | 440 | 66.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16754-PA | 132 | GA16754-PA | 1..131 | 1..139 | 435 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14987-PA | 141 | GM14987-PA | 1..129 | 1..129 | 645 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14764-PA | 141 | GD14764-PA | 1..141 | 1..141 | 648 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11227-PA | 132 | GJ11227-PA | 1..120 | 1..129 | 347 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12066-PA | 156 | GK12066-PA | 1..140 | 1..122 | 379 | 55 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19969-PA | 141 | GE19969-PA | 1..141 | 1..141 | 665 | 92.2 | Plus |
Translation from 75 to 500
> IP06311.hyp MLLNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVE LLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGS EPGPNTPAARKPRKQKAKQAPINPNPVIAPPHQQPQPPLLT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32202-PA | 141 | CG32202-PA | 1..141 | 1..141 | 758 | 100 | Plus |