BDGP Sequence Production Resources |
Search the DGRC for IP06343
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 63 |
Well: | 43 |
Vector: | pOT2 |
Associated Gene/Transcript | CG5693-RA |
Protein status: | IP06343.pep: gold |
Preliminary Size: | 389 |
Sequenced Size: | 550 |
Gene | Date | Evidence |
---|---|---|
CG5693 | 2005-01-01 | Successful iPCR screen |
CG5693 | 2008-04-29 | Release 5.5 accounting |
CG5693 | 2008-08-15 | Release 5.9 accounting |
CG5693 | 2008-12-18 | 5.12 accounting |
550 bp (550 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023611
> IP06343.complete CAGTTAGCATCTATGTAAATTCACAAAATCTATAAAGTGGGACCCAATTT GCCACTGCCATCTGCCTCGACCTTCGTTTTCAGTGGAGGTGCTGCAGCAT GCCTTGCATATTTAATCCGGGCTACATTGGACCCGATCCGCCCTGCTGTG ACCCCGATTGCTTGGAGGAGGGCCACTGCACGGTTCCGGAGTGCGGAGTT TGCCCGGAGTCCCAACTACCCCGATGCAATCCCGCCCCACAATCCAACAA GGACGCGGCGAAGCAACCACTGGACCAGAAAGCCCAAAAAGAACCGAAGC TCCGGGAACAGAAGTAGTGGGGAAAAAGGCAAAGCTGCAAAAATGAACCA GGAGTCCTTTGGAGATGTGCTGAACACACAACCTTGTTGTGTGTTGCTAA TATCTTCAAACATCTTGAGCTAAACCCATTTAGCTCATCATCTCCTGGGC ATCGAACCGTCATATTGTAACATTATATTTCAAAAAAATTAATAATAATA ATAAATAAATAAAATGAATATCTATAAATAATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5693-RA | 538 | CG5693-RA | 7..538 | 1..532 | 2660 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18005330..18005861 | 1..532 | 2600 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18006685..18007221 | 1..537 | 2685 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18006685..18007221 | 1..537 | 2685 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18005330..18005816 | 1..487 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 1..219 | 99..317 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 1..219 | 99..317 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 1..219 | 99..317 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 1..219 | 99..317 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 1..219 | 99..317 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 7..389 | 1..383 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 7..538 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 59..590 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 7..389 | 1..383 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5693-RA | 59..590 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18006685..18007216 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18006685..18007216 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18006685..18007216 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18006685..18007216 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18006685..18007216 | 1..532 | 100 | Plus |
Translation from 98 to 316
> IP06343.hyp MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN KDAAKQPLDQKAQKEPKLREQK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5693-PA | 72 | CG5693-PA | 1..72 | 1..72 | 422 | 100 | Plus |
Translation from 98 to 316
> IP06343.pep MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN KDAAKQPLDQKAQKEPKLREQK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14808-PA | 65 | GF14808-PA | 1..64 | 1..64 | 181 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21098-PA | 72 | GG21098-PA | 1..72 | 1..72 | 260 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11632-PA | 76 | GH11632-PA | 1..48 | 1..46 | 129 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5693-PA | 72 | CG5693-PA | 1..72 | 1..72 | 422 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14554-PA | 69 | GL14554-PA | 1..64 | 1..65 | 168 | 56.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25191-PA | 69 | GA25191-PA | 1..64 | 1..65 | 168 | 56.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17256-PA | 72 | GM17256-PA | 1..72 | 1..72 | 273 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24121-PA | 72 | GD24121-PA | 1..72 | 1..72 | 281 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17705-PA | 81 | GJ17705-PA | 1..66 | 1..64 | 141 | 47 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12803-PA | 72 | GE12803-PA | 1..72 | 1..72 | 259 | 87.5 | Plus |