Clone IP06343 Report

Search the DGRC for IP06343

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:63
Well:43
Vector:pOT2
Associated Gene/TranscriptCG5693-RA
Protein status:IP06343.pep: gold
Preliminary Size:389
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5693 2005-01-01 Successful iPCR screen
CG5693 2008-04-29 Release 5.5 accounting
CG5693 2008-08-15 Release 5.9 accounting
CG5693 2008-12-18 5.12 accounting

Clone Sequence Records

IP06343.complete Sequence

550 bp (550 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023611

> IP06343.complete
CAGTTAGCATCTATGTAAATTCACAAAATCTATAAAGTGGGACCCAATTT
GCCACTGCCATCTGCCTCGACCTTCGTTTTCAGTGGAGGTGCTGCAGCAT
GCCTTGCATATTTAATCCGGGCTACATTGGACCCGATCCGCCCTGCTGTG
ACCCCGATTGCTTGGAGGAGGGCCACTGCACGGTTCCGGAGTGCGGAGTT
TGCCCGGAGTCCCAACTACCCCGATGCAATCCCGCCCCACAATCCAACAA
GGACGCGGCGAAGCAACCACTGGACCAGAAAGCCCAAAAAGAACCGAAGC
TCCGGGAACAGAAGTAGTGGGGAAAAAGGCAAAGCTGCAAAAATGAACCA
GGAGTCCTTTGGAGATGTGCTGAACACACAACCTTGTTGTGTGTTGCTAA
TATCTTCAAACATCTTGAGCTAAACCCATTTAGCTCATCATCTCCTGGGC
ATCGAACCGTCATATTGTAACATTATATTTCAAAAAAATTAATAATAATA
ATAAATAAATAAAATGAATATCTATAAATAATAAAAAAAAAAAAAAAAAA

IP06343.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 538 CG5693-RA 7..538 1..532 2660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18005330..18005861 1..532 2600 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006685..18007221 1..537 2685 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006685..18007221 1..537 2685 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:44:54 has no hits.

IP06343.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:45:56 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18005330..18005816 1..487 99 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:17 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 99..317 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:38 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 99..317 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:41:14 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 99..317 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:35 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 99..317 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:04 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 99..317 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:00 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 7..389 1..383 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:38 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 7..538 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:41:14 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 59..590 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:35 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 7..389 1..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:04 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 59..590 1..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:56 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006685..18007216 1..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:56 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006685..18007216 1..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:56 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006685..18007216 1..532 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:41:14 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006685..18007216 1..532 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:06 Download gff for IP06343.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006685..18007216 1..532 100   Plus

IP06343.hyp Sequence

Translation from 98 to 316

> IP06343.hyp
MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN
KDAAKQPLDQKAQKEPKLREQK*

IP06343.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 72 CG5693-PA 1..72 1..72 422 100 Plus

IP06343.pep Sequence

Translation from 98 to 316

> IP06343.pep
MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN
KDAAKQPLDQKAQKEPKLREQK*

IP06343.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14808-PA 65 GF14808-PA 1..64 1..64 181 57.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21098-PA 72 GG21098-PA 1..72 1..72 260 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11632-PA 76 GH11632-PA 1..48 1..46 129 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 72 CG5693-PA 1..72 1..72 422 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14554-PA 69 GL14554-PA 1..64 1..65 168 56.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25191-PA 69 GA25191-PA 1..64 1..65 168 56.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17256-PA 72 GM17256-PA 1..72 1..72 273 93.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24121-PA 72 GD24121-PA 1..72 1..72 281 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17705-PA 81 GJ17705-PA 1..66 1..64 141 47 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12803-PA 72 GE12803-PA 1..72 1..72 259 87.5 Plus