Clone IP06402 Report

Search the DGRC for IP06402

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:2
Vector:pOT2
Associated Gene/TranscriptCG10581-RA
Protein status:IP06402.pep: gold
Preliminary Size:524
Sequenced Size:604

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10581 2005-01-01 Successful iPCR screen
CG10581 2008-04-29 Release 5.5 accounting
CG10581 2008-08-15 Release 5.9 accounting
CG10581 2008-12-18 5.12 accounting

Clone Sequence Records

IP06402.complete Sequence

604 bp (604 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022513

> IP06402.complete
AATAAGCCGACATGAAGAACCAAAAAAATATAACCATTATACTAACTGGG
CCACCAGGAGTGGGTAAAACTACACTGGTCCACAAAATATGCTCGGCTCT
GCAGGATAGAGGACGCATTCTTCAAGGATTCTACACAGAGGAAATGCGAG
GTGAGGGCACCAGCCAAAGAATCGGCTTCGACGTGGTCACGTTAGCCGGA
AAACGAGCAATCCTATCTCGCAAGAATCCCGGGGACCAGCTGCGACGACC
CAAAGTGGGAGAGTATTCGGTGTTTGTGCAGGACTTCGACAGTCTCGCTC
TGCCAGTACTTGGCACACAGGATTCCCAACCAGAGCCGGATCTCCTGGTC
GTGGATGAAGTGGGCAAAATGGAGCTGCTTAGCAAGCGATTTGAGTCGGC
CATGGCTGATCTCCTGAAGAAAAAGCGGGCCCTATTGGTCACCATACCCG
AGAAATCAACATTGGCTTTGGTGGAGCAGCTGAGAAAGTCAGCAGGATCC
AAGATTTACCAGGTGACCAAATTCAATAGGAACGCCTTGGCTGGAGAGAT
TACAGAAGAGATTACAAAAGCACTTCTTTAACAAAGTAAAAAAAAAAAAA
AAAA

IP06402.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10581-RA 626 CG10581-RA 40..626 1..587 2935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21022563..21023095 587..55 2665 100 Minus
chr3L 24539361 chr3L 21023155..21023212 58..1 290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21033550..21034086 591..55 2685 100 Minus
3L 28110227 3L 21034146..21034203 58..1 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21026650..21027186 591..55 2685 100 Minus
3L 28103327 3L 21027246..21027303 58..1 290 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:02:42 has no hits.

IP06402.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:03:54 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21022563..21023092 58..587 100 <- Minus
chr3L 21023156..21023212 1..57 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:20 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..570 12..581 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:50 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..570 12..581 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:00 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..570 12..581 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:38 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..570 12..581 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:46 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..570 12..581 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:46 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:49 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:00 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:38 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:46 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
CG10581-RA 1..587 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:54 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21033554..21034083 58..587 100 <- Minus
3L 21034147..21034203 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:54 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21033554..21034083 58..587 100 <- Minus
3L 21034147..21034203 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:54 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21033554..21034083 58..587 100 <- Minus
3L 21034147..21034203 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:00 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21026654..21027183 58..587 100 <- Minus
arm_3L 21027247..21027303 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:44 Download gff for IP06402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21026654..21027183 58..587 100 <- Minus
3L 21027247..21027303 1..57 100   Minus

IP06402.hyp Sequence

Translation from 11 to 580

> IP06402.hyp
MKNQKNITIILTGPPGVGKTTLVHKICSALQDRGRILQGFYTEEMRGEGT
SQRIGFDVVTLAGKRAILSRKNPGDQLRRPKVGEYSVFVQDFDSLALPVL
GTQDSQPEPDLLVVDEVGKMELLSKRFESAMADLLKKKRALLVTIPEKST
LALVEQLRKSAGSKIYQVTKFNRNALAGEITEEITKALL*

IP06402.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG10581-PA 189 CG10581-PA 1..189 1..189 937 100 Plus

IP06402.pep Sequence

Translation from 11 to 580

> IP06402.pep
MKNQKNITIILTGPPGVGKTTLVHKICSALQDRGRILQGFYTEEMRGEGT
SQRIGFDVVTLAGKRAILSRKNPGDQLRRPKVGEYSVFVQDFDSLALPVL
GTQDSQPEPDLLVVDEVGKMELLSKRFESAMADLLKKKRALLVTIPEKST
LALVEQLRKSAGSKIYQVTKFNRNALAGEITEEITKALL*

IP06402.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10190-PA 187 GF10190-PA 5..184 9..189 575 61.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13264-PA 188 GG13264-PA 5..188 6..189 836 85.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14943-PA 214 GH14943-PA 1..186 1..189 481 52.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10581-PA 189 CG10581-PA 1..189 1..189 937 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11469-PA 198 GI11469-PA 1..195 1..189 458 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10412-PA 301 GA10412-PA 1..137 1..139 437 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22168-PA 188 GM22168-PA 1..188 1..189 821 86.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12145-PA 188 GD12145-PA 2..188 3..189 896 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13661-PA 189 GJ13661-PA 1..186 1..189 457 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13424-PA 185 GK13424-PA 1..185 1..186 444 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22362-PA 188 GE22362-PA 1..188 1..189 830 84.1 Plus
Dyak\GE22954-PA 188 GE22954-PA 1..188 1..189 815 82.5 Plus