Clone IP06404 Report

Search the DGRC for IP06404

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:4
Vector:pOT2
Associated Gene/TranscriptCG10839-RA
Protein status:IP06404.pep: gold
Preliminary Size:561
Sequenced Size:650

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10839 2005-01-01 Successful iPCR screen
CG10839 2008-04-29 Release 5.5 accounting
CG10839 2008-08-15 Release 5.9 accounting
CG10839 2008-12-18 5.12 accounting

Clone Sequence Records

IP06404.complete Sequence

650 bp (650 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023612

> IP06404.complete
AACATTTTGAATATAAAATTCATACATCATGTCGAAGCCGACAACCCTAA
AGGACGCATTGGCCAAGTGGGAGGACCGCAATAAGCAGCCAGCCGCCACT
GCCACGGAAATTGGACTTCAGTTTCAGTATCCGCCGATCGAGAAAATGGA
TCCGATTCTCAATTCCCTTACCGAGTGCCAAAAGCTCAGCTTGTCCTCAA
ATATGATTGAGAAGATTACTGGAATTTCGGGAATGAAGAACCTGAAAGTC
CTGAGCCTGGCACGTAACAATCTTAAAACGCTCAACGGCATAGAACCACT
GGCCGATACTCTGGAGGAATTGTGGGTCAGCTACAACAACATCGAGAAGA
CCAAGCCCCTGGAATCGATGAAGGCCCTGCGTGTGTTTTACATATCCTTT
AATATGATCAAGGACTGGACGGAGTTCATGCGCATGGGTGTTCCACCAAA
TCTCAGCGAGATCACATTTGTGGGAAATCCTTTGAACGAGAACATGGACC
AGTCTGCCTTCACTGCCGAGGCAGTCCGTCGTCTGCCCAACATGAAGAAA
CTCGATGGGGAGCCTGTCATTCGTTAGGAAAAAACAAGCTATCACGGTTG
TGTTGTATTTCAAATAAAGGTGAATCCAAAGTCGAAAAAAAAAAAAAAAA

IP06404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG10839-RA 656 CG10839-RA 10..644 1..635 3175 100 Plus
CG10839.a 1317 CG10839.a 76..694 1..619 3095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15978334..15978967 1..634 3155 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15979544..15980178 1..635 3175 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15979544..15980178 1..635 3175 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:34:44 has no hits.

IP06404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:35:40 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15978334..15978967 1..634 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:21 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 1..549 29..577 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:14 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 1..549 29..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:33:04 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 1..549 29..577 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:36 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 1..549 29..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:10:03 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 1..549 29..577 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:02 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 10..643 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:14 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 10..643 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:33:04 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 59..692 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:36 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 10..643 1..634 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:10:03 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG10839-RA 59..692 1..634 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:40 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15979544..15980177 1..634 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:40 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15979544..15980177 1..634 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:40 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15979544..15980177 1..634 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:33:04 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15979544..15980177 1..634 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:45 Download gff for IP06404.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15979544..15980177 1..634 100   Plus

IP06404.pep Sequence

Translation from 28 to 576

> IP06404.pep
MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTEC
QKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWV
SYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGN
PLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR*

IP06404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14930-PA 182 GF14930-PA 1..182 1..182 828 85.2 Plus
Dana\GF13083-PA 188 GF13083-PA 1..181 1..181 566 56.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25184-PA 182 GG25184-PA 1..182 1..182 902 95.1 Plus
Dere\GG10560-PA 188 GG10560-PA 1..181 1..181 566 56.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10391-PA 182 GH10391-PA 1..182 1..182 772 77.5 Plus
Dgri\GH20213-PA 187 GH20213-PA 1..182 1..182 555 54.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10839-PB 182 CG10839-PB 1..182 1..182 934 100 Plus
CG10839-PC 182 CG10839-PC 1..182 1..182 934 100 Plus
CG10839-PA 182 CG10839-PA 1..182 1..182 934 100 Plus
CG8800-PA 188 CG8800-PA 1..181 1..181 553 56.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17368-PA 182 GI17368-PA 1..182 1..182 781 79.1 Plus
Dmoj\GI20740-PA 188 GI20740-PA 1..181 1..181 572 57.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15303-PA 182 GL15303-PA 1..182 1..182 757 75.8 Plus
Dper\GL16890-PA 187 GL16890-PA 1..181 1..181 575 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10587-PA 182 GA10587-PA 1..182 1..182 757 75.8 Plus
Dpse\GA21330-PA 187 GA21330-PA 1..181 1..181 574 56.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18645-PA 182 GM18645-PA 1..182 1..182 932 97.8 Plus
Dsec\GM20606-PA 188 GM20606-PA 1..181 1..181 566 56.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24033-PA 182 GD24033-PA 1..182 1..182 936 98.4 Plus
Dsim\GD10079-PA 188 GD10079-PA 1..181 1..181 566 56.4 Plus
Dsim\GD24032-PA 61 GD24032-PA 1..58 1..58 303 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18046-PA 182 GJ18046-PA 1..182 1..182 810 82.4 Plus
Dvir\GJ20477-PA 188 GJ20477-PA 1..181 1..181 565 56.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24767-PA 183 GK24767-PA 1..183 1..182 730 76 Plus
Dwil\GK20865-PA 188 GK20865-PA 1..181 1..181 561 55.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21255-PA 182 GE21255-PA 1..182 1..182 908 95.6 Plus
Dyak\GE22335-PA 188 GE22335-PA 1..181 1..181 566 56.4 Plus

IP06404.hyp Sequence

Translation from 28 to 576

> IP06404.hyp
MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTEC
QKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWV
SYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGN
PLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR*

IP06404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG10839-PB 182 CG10839-PB 1..182 1..182 934 100 Plus
CG10839-PC 182 CG10839-PC 1..182 1..182 934 100 Plus
CG10839-PA 182 CG10839-PA 1..182 1..182 934 100 Plus
CG8800-PA 188 CG8800-PA 1..181 1..181 553 56.4 Plus