Clone IP06411 Report

Search the DGRC for IP06411

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:11
Vector:pOT2
Associated Gene/TranscriptCG11637-RA
Protein status:IP06411.pep: validated not full length
Preliminary Size:546
Sequenced Size:757

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11637 2005-01-01 Successful iPCR screen
CG11637 2008-04-29 Release 5.5 accounting
CG11637 2008-08-15 Release 5.9 accounting
CG11637 2008-12-18 5.12 accounting

Clone Sequence Records

IP06411.complete Sequence

757 bp (757 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022514

> IP06411.complete
TGGACAGCGGCGAGGTGAAAATATCTTTGGAGGATTCCCCCAGCTCCGGG
GAAAGTTTCGCCAGTACAACCAGTGGACCATGTTGCGGTTCTGGCAGGGA
TTTGGATATTCAGGTGCATGAAAGCCATATAAAAGACGACCAGTTCCCAT
CCAGGGCCACCAGTGAATTACAAGAATCCAAAAAATCGAACAAGAAATGT
TCCAGCGATCTTTCGACAGAGAATAGCTATGCTGCCAACAAAAATGTAGC
TGAAGGCCTAATGGATATAGCTTTGCTTTCGGCGAATGCGAATCAGTTGC
GATTCCTGATCACCTATAACGACAAGGCTTCCACGTACATATACAGCATG
ATTATGGTGATACTTTCCCTGGTGCTGCAGCTTTTAGTTGGCATAATGCT
GATCTTTAAACGACGTCTCAAGCGATTTAGGAACCGAAGTTACGAAAGAA
CCAACGATCTGCTCGTAATGGGAGTTTTCATGATCACAGTGATCAACATT
CTGCTGGCCGCATTTACCACAACGGATGGAGGAGGCAGTCATTAGTGAAT
TAACCATACTATACAACTATATGTTTTATTTAAATTTTATATGTGTATAT
ATTTTAATTGTATTTTATACAATATGCATAACAGAATCAACTAAGTGGTA
AATGCTACGTTAACATGGTGAGAACCGATAACGGATGGCCGTCAAAATTG
TTCCAGCGGTTCCCACGCATAAATGCACTTGACGTATCTGAAAAAAAAAA
AAAAAAA

IP06411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11637-RA 749 CG11637-RA 10..749 1..740 3700 100 Plus
CG3902-RA 1663 CG3902-RA 1504..1663 741..582 800 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18882556..18882885 411..740 1650 100 Plus
chr3L 24539361 chr3L 18881991..18882246 1..256 1265 99.6 Plus
chr3L 24539361 chr3L 18882346..18882502 254..410 755 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18892949..18893279 411..741 1655 100 Plus
3L 28110227 3L 18892384..18892639 1..256 1280 100 Plus
3L 28110227 3L 18892739..18892895 254..410 785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18886049..18886379 411..741 1655 100 Plus
3L 28103327 3L 18885484..18885739 1..256 1280 100 Plus
3L 28103327 3L 18885839..18885995 254..410 785 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:57:45 has no hits.

IP06411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:58:35 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18881991..18882245 1..255 99 -> Plus
chr3L 18882348..18882502 256..410 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:24 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:51 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:27 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
NijB-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:39 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:42 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
NijB-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:48 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:51 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..741 1..740 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:27 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
NijB-RA 2..741 1..740 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:39 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11637-RA 2..546 1..545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:42 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
NijB-RA 2..741 1..740 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:35 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18892741..18892895 256..410 100 -> Plus
3L 18892949..18893278 411..740 100   Plus
3L 18892384..18892638 1..255 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:35 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18892741..18892895 256..410 100 -> Plus
3L 18892949..18893278 411..740 100   Plus
3L 18892384..18892638 1..255 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:35 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18892741..18892895 256..410 100 -> Plus
3L 18892949..18893278 411..740 100   Plus
3L 18892384..18892638 1..255 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:27 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18885484..18885738 1..255 100 -> Plus
arm_3L 18885841..18885995 256..410 100 -> Plus
arm_3L 18886049..18886378 411..740 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:45 Download gff for IP06411.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18885841..18885995 256..410 100 -> Plus
3L 18886049..18886378 411..740 100   Plus
3L 18885484..18885738 1..255 100 -> Plus

IP06411.pep Sequence

Translation from 2 to 544

> IP06411.pep
DSGEVKISLEDSPSSGESFASTTSGPCCGSGRDLDIQVHESHIKDDQFPS
RATSELQESKKSNKKCSSDLSTENSYAANKNVAEGLMDIALLSANANQLR
FLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRRLKRFRNRSYERT
NDLLVMGVFMITVINILLAAFTTTDGGGSH*

IP06411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23648-PA 179 GF23648-PA 2..178 1..178 593 72.5 Plus
Dana\GF23821-PA 231 GF23821-PA 114..226 66..175 196 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16012-PA 180 GG16012-PA 2..177 1..176 817 89.8 Plus
Dere\GG13962-PA 235 GG13962-PA 123..227 74..175 193 37.1 Plus
Dere\GG19192-PA 203 GG19192-PA 7..139 74..171 146 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14600-PA 174 GH14600-PA 4..171 2..176 424 59.1 Plus
Dgri\GH15570-PA 228 GH15570-PA 117..221 74..175 207 39.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
NijB-PA 181 CG11637-PA 2..181 1..180 899 100 Plus
NijC-PF 133 CG14394-PF 14..114 74..171 192 37.9 Plus
NijC-PD 138 CG14394-PD 19..119 74..171 192 37.9 Plus
NijA-PD 225 CG6449-PD 110..211 74..172 190 37.3 Plus
NijA-PC 229 CG6449-PC 114..215 74..172 190 37.3 Plus
NijA-PA 241 CG6449-PA 126..227 74..172 190 37.3 Plus
NijA-PB 245 CG6449-PB 130..231 74..172 190 37.3 Plus
NijC-PE 131 CG14394-PE 14..117 74..171 156 32.7 Plus
NijC-PC 136 CG14394-PC 19..122 74..171 156 32.7 Plus
NijC-PG 130 CG14394-PG 14..114 74..171 146 30.4 Plus
NijC-PB 135 CG14394-PB 19..119 74..171 146 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13486-PA 170 GI13486-PA 4..167 2..176 497 62.3 Plus
Dmoj\GI16845-PA 228 GI16845-PA 117..221 74..175 211 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24889-PA 173 GL24889-PA 2..170 1..176 494 67.6 Plus
Dper\GL20739-PA 243 GL20739-PA 125..237 66..175 204 34.2 Plus
Dper\GL24423-PA 181 GL24423-PA 13..162 58..171 141 27.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11113-PA 173 GA11113-PA 23..170 22..176 443 69.7 Plus
Dpse\GA19603-PA 245 GA19603-PA 135..239 74..175 203 36.8 Plus
Dpse\GA12950-PE 141 GA12950-PE 22..122 74..171 181 36.9 Plus
Dpse\GA12950-PH 126 GA12950-PH 7..107 74..171 179 36.9 Plus
Dpse\GA12950-PF 126 GA12950-PF 7..69 74..136 139 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15001-PA 177 GM15001-PA 3..176 2..175 796 95.4 Plus
Dsec\GM24058-PA 170 GM24058-PA 19..151 74..171 145 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14779-PA 90 GD14779-PA 1..89 87..175 447 98.9 Plus
Dsim\GD12851-PA 246 GD12851-PA 128..229 74..172 194 37.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11847-PA 171 GJ11847-PA 6..168 4..176 373 59.5 Plus
Dvir\GJ12595-PA 230 GJ12595-PA 119..223 74..175 205 36.8 Plus
Dvir\GJ23184-PA 158 GJ23184-PA 7..139 74..171 138 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20451-PA 243 GK20451-PA 66..238 1..172 395 49.7 Plus
Dwil\GK17290-PA 226 GK17290-PA 114..218 74..174 207 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19573-PA 180 GE19573-PA 2..180 1..180 819 88.3 Plus
Dyak\GE19577-PA 180 GE19577-PA 2..180 1..180 814 87.8 Plus
Dyak\GE20261-PA 231 GE20261-PA 115..215 74..171 203 42.5 Plus
Dyak\GE26216-PA 232 GE26216-PA 7..139 74..171 143 28.9 Plus

IP06411.hyp Sequence

Translation from 2 to 544

> IP06411.hyp
DSGEVKISLEDSPSSGESFASTTSGPCCGSGRDLDIQVHESHIKDDQFPS
RATSELQESKKSNKKCSSDLSTENSYAANKNVAEGLMDIALLSANANQLR
FLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRRLKRFRNRSYERT
NDLLVMGVFMITVINILLAAFTTTDGGGSH*

IP06411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
NijB-PA 181 CG11637-PA 2..181 1..180 899 100 Plus
NijC-PF 133 CG14394-PF 14..114 74..171 192 37.9 Plus
NijC-PD 138 CG14394-PD 19..119 74..171 192 37.9 Plus
NijA-PD 225 CG6449-PD 110..211 74..172 190 37.3 Plus
NijA-PC 229 CG6449-PC 114..215 74..172 190 37.3 Plus