BDGP Sequence Production Resources |
Search the DGRC for IP06411
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 64 |
Well: | 11 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11637-RA |
Protein status: | IP06411.pep: validated not full length |
Preliminary Size: | 546 |
Sequenced Size: | 757 |
Gene | Date | Evidence |
---|---|---|
CG11637 | 2005-01-01 | Successful iPCR screen |
CG11637 | 2008-04-29 | Release 5.5 accounting |
CG11637 | 2008-08-15 | Release 5.9 accounting |
CG11637 | 2008-12-18 | 5.12 accounting |
757 bp (757 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022514
> IP06411.complete TGGACAGCGGCGAGGTGAAAATATCTTTGGAGGATTCCCCCAGCTCCGGG GAAAGTTTCGCCAGTACAACCAGTGGACCATGTTGCGGTTCTGGCAGGGA TTTGGATATTCAGGTGCATGAAAGCCATATAAAAGACGACCAGTTCCCAT CCAGGGCCACCAGTGAATTACAAGAATCCAAAAAATCGAACAAGAAATGT TCCAGCGATCTTTCGACAGAGAATAGCTATGCTGCCAACAAAAATGTAGC TGAAGGCCTAATGGATATAGCTTTGCTTTCGGCGAATGCGAATCAGTTGC GATTCCTGATCACCTATAACGACAAGGCTTCCACGTACATATACAGCATG ATTATGGTGATACTTTCCCTGGTGCTGCAGCTTTTAGTTGGCATAATGCT GATCTTTAAACGACGTCTCAAGCGATTTAGGAACCGAAGTTACGAAAGAA CCAACGATCTGCTCGTAATGGGAGTTTTCATGATCACAGTGATCAACATT CTGCTGGCCGCATTTACCACAACGGATGGAGGAGGCAGTCATTAGTGAAT TAACCATACTATACAACTATATGTTTTATTTAAATTTTATATGTGTATAT ATTTTAATTGTATTTTATACAATATGCATAACAGAATCAACTAAGTGGTA AATGCTACGTTAACATGGTGAGAACCGATAACGGATGGCCGTCAAAATTG TTCCAGCGGTTCCCACGCATAAATGCACTTGACGTATCTGAAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18882556..18882885 | 411..740 | 1650 | 100 | Plus |
chr3L | 24539361 | chr3L | 18881991..18882246 | 1..256 | 1265 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 18882346..18882502 | 254..410 | 755 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 18892949..18893279 | 411..741 | 1655 | 100 | Plus |
3L | 28110227 | 3L | 18892384..18892639 | 1..256 | 1280 | 100 | Plus |
3L | 28110227 | 3L | 18892739..18892895 | 254..410 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18886049..18886379 | 411..741 | 1655 | 100 | Plus |
3L | 28103327 | 3L | 18885484..18885739 | 1..256 | 1280 | 100 | Plus |
3L | 28103327 | 3L | 18885839..18885995 | 254..410 | 785 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18881991..18882245 | 1..255 | 99 | -> | Plus |
chr3L | 18882348..18882502 | 256..410 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NijB-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NijB-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..741 | 1..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NijB-RA | 2..741 | 1..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11637-RA | 2..546 | 1..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NijB-RA | 2..741 | 1..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18892741..18892895 | 256..410 | 100 | -> | Plus |
3L | 18892949..18893278 | 411..740 | 100 | Plus | |
3L | 18892384..18892638 | 1..255 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18892741..18892895 | 256..410 | 100 | -> | Plus |
3L | 18892949..18893278 | 411..740 | 100 | Plus | |
3L | 18892384..18892638 | 1..255 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18892741..18892895 | 256..410 | 100 | -> | Plus |
3L | 18892949..18893278 | 411..740 | 100 | Plus | |
3L | 18892384..18892638 | 1..255 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18885484..18885738 | 1..255 | 100 | -> | Plus |
arm_3L | 18885841..18885995 | 256..410 | 100 | -> | Plus |
arm_3L | 18886049..18886378 | 411..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18885841..18885995 | 256..410 | 100 | -> | Plus |
3L | 18886049..18886378 | 411..740 | 100 | Plus | |
3L | 18885484..18885738 | 1..255 | 100 | -> | Plus |
Translation from 2 to 544
> IP06411.pep DSGEVKISLEDSPSSGESFASTTSGPCCGSGRDLDIQVHESHIKDDQFPS RATSELQESKKSNKKCSSDLSTENSYAANKNVAEGLMDIALLSANANQLR FLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRRLKRFRNRSYERT NDLLVMGVFMITVINILLAAFTTTDGGGSH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23648-PA | 179 | GF23648-PA | 2..178 | 1..178 | 593 | 72.5 | Plus |
Dana\GF23821-PA | 231 | GF23821-PA | 114..226 | 66..175 | 196 | 34.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16012-PA | 180 | GG16012-PA | 2..177 | 1..176 | 817 | 89.8 | Plus |
Dere\GG13962-PA | 235 | GG13962-PA | 123..227 | 74..175 | 193 | 37.1 | Plus |
Dere\GG19192-PA | 203 | GG19192-PA | 7..139 | 74..171 | 146 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14600-PA | 174 | GH14600-PA | 4..171 | 2..176 | 424 | 59.1 | Plus |
Dgri\GH15570-PA | 228 | GH15570-PA | 117..221 | 74..175 | 207 | 39.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NijB-PA | 181 | CG11637-PA | 2..181 | 1..180 | 899 | 100 | Plus |
NijC-PF | 133 | CG14394-PF | 14..114 | 74..171 | 192 | 37.9 | Plus |
NijC-PD | 138 | CG14394-PD | 19..119 | 74..171 | 192 | 37.9 | Plus |
NijA-PD | 225 | CG6449-PD | 110..211 | 74..172 | 190 | 37.3 | Plus |
NijA-PC | 229 | CG6449-PC | 114..215 | 74..172 | 190 | 37.3 | Plus |
NijA-PA | 241 | CG6449-PA | 126..227 | 74..172 | 190 | 37.3 | Plus |
NijA-PB | 245 | CG6449-PB | 130..231 | 74..172 | 190 | 37.3 | Plus |
NijC-PE | 131 | CG14394-PE | 14..117 | 74..171 | 156 | 32.7 | Plus |
NijC-PC | 136 | CG14394-PC | 19..122 | 74..171 | 156 | 32.7 | Plus |
NijC-PG | 130 | CG14394-PG | 14..114 | 74..171 | 146 | 30.4 | Plus |
NijC-PB | 135 | CG14394-PB | 19..119 | 74..171 | 146 | 30.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13486-PA | 170 | GI13486-PA | 4..167 | 2..176 | 497 | 62.3 | Plus |
Dmoj\GI16845-PA | 228 | GI16845-PA | 117..221 | 74..175 | 211 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24889-PA | 173 | GL24889-PA | 2..170 | 1..176 | 494 | 67.6 | Plus |
Dper\GL20739-PA | 243 | GL20739-PA | 125..237 | 66..175 | 204 | 34.2 | Plus |
Dper\GL24423-PA | 181 | GL24423-PA | 13..162 | 58..171 | 141 | 27.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11113-PA | 173 | GA11113-PA | 23..170 | 22..176 | 443 | 69.7 | Plus |
Dpse\GA19603-PA | 245 | GA19603-PA | 135..239 | 74..175 | 203 | 36.8 | Plus |
Dpse\GA12950-PE | 141 | GA12950-PE | 22..122 | 74..171 | 181 | 36.9 | Plus |
Dpse\GA12950-PH | 126 | GA12950-PH | 7..107 | 74..171 | 179 | 36.9 | Plus |
Dpse\GA12950-PF | 126 | GA12950-PF | 7..69 | 74..136 | 139 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15001-PA | 177 | GM15001-PA | 3..176 | 2..175 | 796 | 95.4 | Plus |
Dsec\GM24058-PA | 170 | GM24058-PA | 19..151 | 74..171 | 145 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14779-PA | 90 | GD14779-PA | 1..89 | 87..175 | 447 | 98.9 | Plus |
Dsim\GD12851-PA | 246 | GD12851-PA | 128..229 | 74..172 | 194 | 37.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11847-PA | 171 | GJ11847-PA | 6..168 | 4..176 | 373 | 59.5 | Plus |
Dvir\GJ12595-PA | 230 | GJ12595-PA | 119..223 | 74..175 | 205 | 36.8 | Plus |
Dvir\GJ23184-PA | 158 | GJ23184-PA | 7..139 | 74..171 | 138 | 28.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20451-PA | 243 | GK20451-PA | 66..238 | 1..172 | 395 | 49.7 | Plus |
Dwil\GK17290-PA | 226 | GK17290-PA | 114..218 | 74..174 | 207 | 39.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19573-PA | 180 | GE19573-PA | 2..180 | 1..180 | 819 | 88.3 | Plus |
Dyak\GE19577-PA | 180 | GE19577-PA | 2..180 | 1..180 | 814 | 87.8 | Plus |
Dyak\GE20261-PA | 231 | GE20261-PA | 115..215 | 74..171 | 203 | 42.5 | Plus |
Dyak\GE26216-PA | 232 | GE26216-PA | 7..139 | 74..171 | 143 | 28.9 | Plus |
Translation from 2 to 544
> IP06411.hyp DSGEVKISLEDSPSSGESFASTTSGPCCGSGRDLDIQVHESHIKDDQFPS RATSELQESKKSNKKCSSDLSTENSYAANKNVAEGLMDIALLSANANQLR FLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRRLKRFRNRSYERT NDLLVMGVFMITVINILLAAFTTTDGGGSH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NijB-PA | 181 | CG11637-PA | 2..181 | 1..180 | 899 | 100 | Plus |
NijC-PF | 133 | CG14394-PF | 14..114 | 74..171 | 192 | 37.9 | Plus |
NijC-PD | 138 | CG14394-PD | 19..119 | 74..171 | 192 | 37.9 | Plus |
NijA-PD | 225 | CG6449-PD | 110..211 | 74..172 | 190 | 37.3 | Plus |
NijA-PC | 229 | CG6449-PC | 114..215 | 74..172 | 190 | 37.3 | Plus |