BDGP Sequence Production Resources |
Search the DGRC for IP06415
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 64 |
Well: | 15 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12027-RA |
Protein status: | IP06415.pep: gold |
Preliminary Size: | 552 |
Sequenced Size: | 656 |
Gene | Date | Evidence |
---|---|---|
CG12027 | 2005-01-01 | Successful iPCR screen |
CG12027 | 2008-04-29 | Release 5.5 accounting |
CG12027 | 2008-08-15 | Release 5.9 accounting |
CG12027 | 2008-12-18 | 5.12 accounting |
656 bp (656 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023609
> IP06415.complete ACAGTATCGTGTCAGCAGAGAACAAAACTAACAAAAAAATGTTTAGCCGT TTCCTAAAACCAAGCCTAGTTTTATGTAGGAGTGTGAGCAATACCGCATC CCTTCGCTACAAGGATCCCATTTATCAGATTTTCCTGGACAAGGTGCGCG AGTATCGGCTGAAGAGTCCCAAGGGAAAGCCCGTAGATCCTGGTCCGGAA TTCGAGGCGGAGCTGAAGGAAGTCACTGAGCGCCTGGCTCTGCAATACGG CGGCGGCGAGGGCGTGGATATGCTCGAGTTTCCGAAATTCAAGTTGCCCG ATATTGATATTGATCCCATTTCGGTTGATGATCTACCAGAGAACCAACCA AAGCCTGAGAAAAAGAATAGAGATAAAGAAGTAAAGGCCAAAGAAAAGGG TGGGGAAAAAGAAGTGAAAGCCAAAGATGGCAAGAAAGCTGACGAACCAA AGGGCAAGGATGAAAAGGACAAGATAAAGTAGATCATCACTAAAAATAAT CGTTTTAAATGTTGTTAAAATTTTCGCACAATTCTTAATACTTTAAAAAT TATAAAATGTTTATGTTAAAAGAAAATGAATTTAAATGCCTGCAGATTCG AGCTACCCGTTTGTAGCTGTTCCAGGATAGAGCCGAAAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12027-RA | 618 | CG12027-RA | 48..618 | 1..571 | 2855 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Idefix | 7411 | Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). | 2481..2543 | 456..519 | 128 | 68.8 | Plus |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 1424..1532 | 451..558 | 111 | 59.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 5010955..5011255 | 335..635 | 99 | <- | Minus |
chr3L | 5011311..5011644 | 1..334 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..444 | 39..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..444 | 39..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..444 | 39..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..444 | 39..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..444 | 39..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..552 | 20..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..552 | 20..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..552 | 20..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12027-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5011444..5011744 | 335..635 | 100 | <- | Minus |
3L | 5011800..5012133 | 1..334 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5011444..5011744 | 335..635 | 100 | <- | Minus |
3L | 5011800..5012133 | 1..334 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5011444..5011744 | 335..635 | 100 | <- | Minus |
3L | 5011800..5012133 | 1..334 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 5011444..5011744 | 335..635 | 100 | <- | Minus |
arm_3L | 5011800..5012133 | 1..334 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5011444..5011744 | 335..635 | 100 | <- | Minus |
3L | 5011800..5012133 | 1..334 | 100 | Minus |
Translation from 2 to 481
> IP06415.hyp SIVSAENKTNKKMFSRFLKPSLVLCRSVSNTASLRYKDPIYQIFLDKVRE YRLKSPKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPD IDIDPISVDDLPENQPKPEKKNRDKEVKAKEKGGEKEVKAKDGKKADEPK GKDEKDKIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12027-PA | 147 | CG12027-PA | 1..147 | 13..159 | 766 | 100 | Plus |
ATPsyn-Cf6-PB | 106 | CG4412-PB | 33..102 | 38..107 | 203 | 54.3 | Plus |
ATPsyn-Cf6-PC | 106 | CG4412-PC | 33..102 | 38..107 | 203 | 54.3 | Plus |
ATPsyn-Cf6-PA | 106 | CG4412-PA | 33..102 | 38..107 | 203 | 54.3 | Plus |
Translation from 38 to 481
> IP06415.pep MFSRFLKPSLVLCRSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGKPVD PGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPDIDIDPISVDDLP ENQPKPEKKNRDKEVKAKEKGGEKEVKAKDGKKADEPKGKDEKDKIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24705-PA | 153 | GF24705-PA | 1..113 | 1..114 | 336 | 58.8 | Plus |
Dana\GF18010-PA | 106 | GF18010-PA | 33..102 | 26..95 | 198 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14149-PA | 147 | GG14149-PA | 1..123 | 1..123 | 525 | 80.5 | Plus |
Dere\GG12440-PA | 106 | GG12440-PA | 33..102 | 26..95 | 195 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18020-PA | 106 | GH18020-PA | 11..102 | 4..95 | 219 | 51.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsynCF6L-PA | 147 | CG12027-PA | 1..147 | 1..147 | 766 | 100 | Plus |
ATPsynCF6-PB | 106 | CG4412-PB | 33..102 | 26..95 | 203 | 54.3 | Plus |
ATPsynCF6-PC | 106 | CG4412-PC | 33..102 | 26..95 | 203 | 54.3 | Plus |
ATPsynCF6-PA | 106 | CG4412-PA | 33..102 | 26..95 | 203 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23616-PA | 106 | GI23616-PA | 33..102 | 26..95 | 223 | 64.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13184-PA | 99 | GL13184-PA | 10..97 | 9..96 | 303 | 65.9 | Plus |
Dper\GL13700-PA | 106 | GL13700-PA | 30..102 | 23..95 | 186 | 50.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11349-PA | 180 | GA11349-PA | 10..140 | 9..140 | 334 | 53.6 | Plus |
Dpse\GA18167-PA | 106 | GA18167-PA | 30..102 | 23..95 | 186 | 50.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13936-PA | 147 | GM13936-PA | 1..137 | 1..137 | 650 | 94.2 | Plus |
Dsec\GM23571-PA | 106 | GM23571-PA | 33..102 | 26..95 | 195 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13216-PA | 147 | GD13216-PA | 1..136 | 1..136 | 649 | 94.1 | Plus |
Dsim\GD18388-PA | 106 | GD18388-PA | 33..102 | 26..95 | 195 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23589-PA | 106 | GJ23589-PA | 33..102 | 26..95 | 216 | 62.9 | Plus |