Clone IP06415 Report

Search the DGRC for IP06415

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:15
Vector:pOT2
Associated Gene/TranscriptCG12027-RA
Protein status:IP06415.pep: gold
Preliminary Size:552
Sequenced Size:656

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12027 2005-01-01 Successful iPCR screen
CG12027 2008-04-29 Release 5.5 accounting
CG12027 2008-08-15 Release 5.9 accounting
CG12027 2008-12-18 5.12 accounting

Clone Sequence Records

IP06415.complete Sequence

656 bp (656 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023609

> IP06415.complete
ACAGTATCGTGTCAGCAGAGAACAAAACTAACAAAAAAATGTTTAGCCGT
TTCCTAAAACCAAGCCTAGTTTTATGTAGGAGTGTGAGCAATACCGCATC
CCTTCGCTACAAGGATCCCATTTATCAGATTTTCCTGGACAAGGTGCGCG
AGTATCGGCTGAAGAGTCCCAAGGGAAAGCCCGTAGATCCTGGTCCGGAA
TTCGAGGCGGAGCTGAAGGAAGTCACTGAGCGCCTGGCTCTGCAATACGG
CGGCGGCGAGGGCGTGGATATGCTCGAGTTTCCGAAATTCAAGTTGCCCG
ATATTGATATTGATCCCATTTCGGTTGATGATCTACCAGAGAACCAACCA
AAGCCTGAGAAAAAGAATAGAGATAAAGAAGTAAAGGCCAAAGAAAAGGG
TGGGGAAAAAGAAGTGAAAGCCAAAGATGGCAAGAAAGCTGACGAACCAA
AGGGCAAGGATGAAAAGGACAAGATAAAGTAGATCATCACTAAAAATAAT
CGTTTTAAATGTTGTTAAAATTTTCGCACAATTCTTAATACTTTAAAAAT
TATAAAATGTTTATGTTAAAAGAAAATGAATTTAAATGCCTGCAGATTCG
AGCTACCCGTTTGTAGCTGTTCCAGGATAGAGCCGAAAAAAAAAAAAAAA
AAAAAA

IP06415.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12027-RA 618 CG12027-RA 48..618 1..571 2855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5011311..5011644 334..1 1655 99.7 Minus
chr3L 24539361 chr3L 5010955..5011255 635..335 1475 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5011800..5012133 334..1 1670 100 Minus
3L 28110227 3L 5011438..5011744 641..335 1535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5011800..5012133 334..1 1670 100 Minus
3L 28103327 3L 5011438..5011744 641..335 1535 100 Minus
Blast to na_te.dros performed 2019-03-16 01:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 2481..2543 456..519 128 68.8 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1424..1532 451..558 111 59.8 Plus

IP06415.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:41:53 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5010955..5011255 335..635 99 <- Minus
chr3L 5011311..5011644 1..334 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:26 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..444 39..482 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:22 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..444 39..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:22 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..444 39..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:45 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..444 39..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:39:17 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..444 39..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:16 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..552 20..571 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:22 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..552 20..571 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:22 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:45 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..552 20..571 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:39:17 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
CG12027-RA 1..635 1..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:53 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5011444..5011744 335..635 100 <- Minus
3L 5011800..5012133 1..334 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:53 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5011444..5011744 335..635 100 <- Minus
3L 5011800..5012133 1..334 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:53 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5011444..5011744 335..635 100 <- Minus
3L 5011800..5012133 1..334 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:22 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5011444..5011744 335..635 100 <- Minus
arm_3L 5011800..5012133 1..334 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:38 Download gff for IP06415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5011444..5011744 335..635 100 <- Minus
3L 5011800..5012133 1..334 100   Minus

IP06415.hyp Sequence

Translation from 2 to 481

> IP06415.hyp
SIVSAENKTNKKMFSRFLKPSLVLCRSVSNTASLRYKDPIYQIFLDKVRE
YRLKSPKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPD
IDIDPISVDDLPENQPKPEKKNRDKEVKAKEKGGEKEVKAKDGKKADEPK
GKDEKDKIK*

IP06415.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12027-PA 147 CG12027-PA 1..147 13..159 766 100 Plus
ATPsyn-Cf6-PB 106 CG4412-PB 33..102 38..107 203 54.3 Plus
ATPsyn-Cf6-PC 106 CG4412-PC 33..102 38..107 203 54.3 Plus
ATPsyn-Cf6-PA 106 CG4412-PA 33..102 38..107 203 54.3 Plus

IP06415.pep Sequence

Translation from 38 to 481

> IP06415.pep
MFSRFLKPSLVLCRSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGKPVD
PGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPDIDIDPISVDDLP
ENQPKPEKKNRDKEVKAKEKGGEKEVKAKDGKKADEPKGKDEKDKIK*

IP06415.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24705-PA 153 GF24705-PA 1..113 1..114 336 58.8 Plus
Dana\GF18010-PA 106 GF18010-PA 33..102 26..95 198 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14149-PA 147 GG14149-PA 1..123 1..123 525 80.5 Plus
Dere\GG12440-PA 106 GG12440-PA 33..102 26..95 195 54.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18020-PA 106 GH18020-PA 11..102 4..95 219 51.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynCF6L-PA 147 CG12027-PA 1..147 1..147 766 100 Plus
ATPsynCF6-PB 106 CG4412-PB 33..102 26..95 203 54.3 Plus
ATPsynCF6-PC 106 CG4412-PC 33..102 26..95 203 54.3 Plus
ATPsynCF6-PA 106 CG4412-PA 33..102 26..95 203 54.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23616-PA 106 GI23616-PA 33..102 26..95 223 64.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13184-PA 99 GL13184-PA 10..97 9..96 303 65.9 Plus
Dper\GL13700-PA 106 GL13700-PA 30..102 23..95 186 50.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11349-PA 180 GA11349-PA 10..140 9..140 334 53.6 Plus
Dpse\GA18167-PA 106 GA18167-PA 30..102 23..95 186 50.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13936-PA 147 GM13936-PA 1..137 1..137 650 94.2 Plus
Dsec\GM23571-PA 106 GM23571-PA 33..102 26..95 195 54.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13216-PA 147 GD13216-PA 1..136 1..136 649 94.1 Plus
Dsim\GD18388-PA 106 GD18388-PA 33..102 26..95 195 54.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23589-PA 106 GJ23589-PA 33..102 26..95 216 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17585-PA 153 GK17585-PA 16..107 16..105 227 48.9 Plus
Dwil\GK12240-PA 106 GK12240-PA 33..102 26..95 201 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20577-PA 147 GE20577-PA 1..117 1..117 527 83.8 Plus
Dyak\GE23963-PA 106 GE23963-PA 33..102 26..95 195 54.3 Plus