Clone IP06419 Report

Search the DGRC for IP06419

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:19
Vector:pOT2
Associated Gene/TranscriptCG12464-RA
Protein status:IP06419.pep: gold
Preliminary Size:514
Sequenced Size:482

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12464 2005-01-01 Successful iPCR screen
CG12464 2008-04-29 Release 5.5 accounting
CG12464 2008-08-15 Release 5.9 accounting
CG12464 2008-12-18 5.12 accounting

Clone Sequence Records

IP06419.complete Sequence

482 bp (482 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023610

> IP06419.complete
ATTATTTTGTATGAAATACAGCCCCACCATGCGTGCTCCTTTAAGAATTC
CGCTTTTATGGCGCCCAACGTTTTGGCGCTTGAAGATCGCTTATGGTTAC
TCAAAGGATGTCAATACCCTCAAGCGTTTGGGCGCCAGTCCGCGAAATGT
ACGCGATCACCCCGAAGGATGTACGCCCCAAACTTTGAACACAACTGCCT
TCACTACTCCCGATTTCATACACCCATCCACCTATCGGATTGTGGATAAA
AAGGAGCAACTTGGACCCAAGGCAGGAAAAAAGCAAACGTACAAGAATCC
CGAGTACTACAGCTATTATCGCTACTCGTACTACGAGCTGAAGACAATCG
TGGATACCATTAAAAAGAAGCAATCATCTAAGAAGTAATAACAAGACGCA
CCAAATTAGAAGCACTGAAAGAAATTTCATTAATAAAGTAATATTTATTT
TCCATAGCTGTCGAAAAAAAAAAAAAAAAAAA

IP06419.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12464-RA 506 CG12464-RA 44..506 1..463 2315 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9495974..9496436 463..1 2315 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13608668..13609135 468..1 2340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13609867..13610334 468..1 2340 100 Minus
Blast to na_te.dros performed 2019-03-15 21:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 999..1038 460..421 110 75 Minus
412 7567 412 412 7567bp 6750..6881 331..456 106 56.1 Plus

IP06419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:23 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9495974..9496436 1..463 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:27 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 1..378 11..388 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:27 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 1..378 11..388 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:42 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 1..378 11..388 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:43:33 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 1..378 11..388 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:42 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 1..378 11..388 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:39 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 44..506 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:26 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 44..506 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:42 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 44..506 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:34 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 44..506 1..463 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:42 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
CG12464-RA 44..506 1..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:23 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13608673..13609135 1..463 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:23 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13608673..13609135 1..463 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:23 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13608673..13609135 1..463 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:42 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9496178..9496640 1..463 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:04 Download gff for IP06419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13609872..13610334 1..463 100   Minus

IP06419.hyp Sequence

Translation from 0 to 387

> IP06419.hyp
LFCMKYSPTMRAPLRIPLLWRPTFWRLKIAYGYSKDVNTLKRLGASPRNV
RDHPEGCTPQTLNTTAFTTPDFIHPSTYRIVDKKEQLGPKAGKKQTYKNP
EYYSYYRYSYYELKTIVDTIKKKQSSKK*

IP06419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12464-PA 125 CG12464-PA 1..125 4..128 678 100 Plus
CG11815-PA 283 CG11815-PA 31..100 46..113 140 41.4 Plus

IP06419.pep Sequence

Translation from 10 to 387

> IP06419.pep
MKYSPTMRAPLRIPLLWRPTFWRLKIAYGYSKDVNTLKRLGASPRNVRDH
PEGCTPQTLNTTAFTTPDFIHPSTYRIVDKKEQLGPKAGKKQTYKNPEYY
SYYRYSYYELKTIVDTIKKKQSSKK*

IP06419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11168-PA 141 GF11168-PA 52..141 35..124 264 68.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22475-PA 119 GG22475-PA 1..119 7..125 470 84 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20872-PA 290 GH20872-PA 31..117 32..118 191 46 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12464-PA 125 CG12464-PA 1..125 1..125 678 100 Plus
CG11815-PA 283 CG11815-PA 31..100 43..110 140 41.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18630-PA 150 GI18630-PA 61..135 37..111 193 48 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17003-PA 141 GL17003-PA 57..138 37..123 211 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11649-PA 141 GA11649-PA 57..138 37..123 211 47.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20259-PA 125 GM20259-PA 1..125 1..125 560 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25745-PA 119 GD25745-PA 1..119 7..125 540 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20700-PA 122 GJ20700-PA 36..115 39..118 255 57.5 Plus
Dvir\GJ21639-PA 130 GJ21639-PA 44..117 39..112 192 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17948-PA 125 GK17948-PA 49..111 56..118 172 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13345-PA 138 GE13345-PA 16..138 3..125 476 82.1 Plus