BDGP Sequence Production Resources |
Search the DGRC for IP06419
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 64 |
Well: | 19 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12464-RA |
Protein status: | IP06419.pep: gold |
Preliminary Size: | 514 |
Sequenced Size: | 482 |
Gene | Date | Evidence |
---|---|---|
CG12464 | 2005-01-01 | Successful iPCR screen |
CG12464 | 2008-04-29 | Release 5.5 accounting |
CG12464 | 2008-08-15 | Release 5.9 accounting |
CG12464 | 2008-12-18 | 5.12 accounting |
482 bp (482 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023610
> IP06419.complete ATTATTTTGTATGAAATACAGCCCCACCATGCGTGCTCCTTTAAGAATTC CGCTTTTATGGCGCCCAACGTTTTGGCGCTTGAAGATCGCTTATGGTTAC TCAAAGGATGTCAATACCCTCAAGCGTTTGGGCGCCAGTCCGCGAAATGT ACGCGATCACCCCGAAGGATGTACGCCCCAAACTTTGAACACAACTGCCT TCACTACTCCCGATTTCATACACCCATCCACCTATCGGATTGTGGATAAA AAGGAGCAACTTGGACCCAAGGCAGGAAAAAAGCAAACGTACAAGAATCC CGAGTACTACAGCTATTATCGCTACTCGTACTACGAGCTGAAGACAATCG TGGATACCATTAAAAAGAAGCAATCATCTAAGAAGTAATAACAAGACGCA CCAAATTAGAAGCACTGAAAGAAATTTCATTAATAAAGTAATATTTATTT TCCATAGCTGTCGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12464-RA | 506 | CG12464-RA | 44..506 | 1..463 | 2315 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9495974..9496436 | 463..1 | 2315 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 13608668..13609135 | 468..1 | 2340 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 13609867..13610334 | 468..1 | 2340 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Transpac | 5249 | Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). | 999..1038 | 460..421 | 110 | 75 | Minus |
412 | 7567 | 412 412 7567bp | 6750..6881 | 331..456 | 106 | 56.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9495974..9496436 | 1..463 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 1..378 | 11..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 1..378 | 11..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 1..378 | 11..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 1..378 | 11..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 1..378 | 11..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 44..506 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 44..506 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 44..506 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 44..506 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12464-RA | 44..506 | 1..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13608673..13609135 | 1..463 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13608673..13609135 | 1..463 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13608673..13609135 | 1..463 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9496178..9496640 | 1..463 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13609872..13610334 | 1..463 | 100 | Minus |
Translation from 0 to 387
> IP06419.hyp LFCMKYSPTMRAPLRIPLLWRPTFWRLKIAYGYSKDVNTLKRLGASPRNV RDHPEGCTPQTLNTTAFTTPDFIHPSTYRIVDKKEQLGPKAGKKQTYKNP EYYSYYRYSYYELKTIVDTIKKKQSSKK*
Translation from 10 to 387
> IP06419.pep MKYSPTMRAPLRIPLLWRPTFWRLKIAYGYSKDVNTLKRLGASPRNVRDH PEGCTPQTLNTTAFTTPDFIHPSTYRIVDKKEQLGPKAGKKQTYKNPEYY SYYRYSYYELKTIVDTIKKKQSSKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11168-PA | 141 | GF11168-PA | 52..141 | 35..124 | 264 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22475-PA | 119 | GG22475-PA | 1..119 | 7..125 | 470 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20872-PA | 290 | GH20872-PA | 31..117 | 32..118 | 191 | 46 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12464-PA | 125 | CG12464-PA | 1..125 | 1..125 | 678 | 100 | Plus |
CG11815-PA | 283 | CG11815-PA | 31..100 | 43..110 | 140 | 41.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18630-PA | 150 | GI18630-PA | 61..135 | 37..111 | 193 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17003-PA | 141 | GL17003-PA | 57..138 | 37..123 | 211 | 47.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11649-PA | 141 | GA11649-PA | 57..138 | 37..123 | 211 | 47.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20259-PA | 125 | GM20259-PA | 1..125 | 1..125 | 560 | 92.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25745-PA | 119 | GD25745-PA | 1..119 | 7..125 | 540 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20700-PA | 122 | GJ20700-PA | 36..115 | 39..118 | 255 | 57.5 | Plus |
Dvir\GJ21639-PA | 130 | GJ21639-PA | 44..117 | 39..112 | 192 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17948-PA | 125 | GK17948-PA | 49..111 | 56..118 | 172 | 52.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13345-PA | 138 | GE13345-PA | 16..138 | 3..125 | 476 | 82.1 | Plus |